SlideShare une entreprise Scribd logo
1  sur  13
Graphics Empire Firesale
What is Graphics Empire Firesale?
It’s all about selling graphics product that can be used in business success this is a
special that can be used by business marketers and resellers to get the highest profit
ever. In the world of marketing,there are different kinds of graphics that you can use
in your marketing business to make it more profitable.
To gain more traffic in your online business you can use professional cover images.
You can also send conversation and sales. Obtain the best web graphics for direct
sales mini site. Creating good graphics design on your sales can easily increase your
sales. You can also apply business icons, websites graphics as well as sales clipart
collection.
It is a brand new Graphics business-in-a-box package that marketers and resellers
can use easily for their sites. The main components of Graphics Empire include:
• 20 Graphics Modules
• Sales Letter & TQ Page
• Sales Video
• Graphics
• Non-Transferable PLR License
20 main graphics modules are listed below:
1. High impact headlines
2. Sexy feature boxes
3. Customizable sales funnel diagrams
4. Fast action bonus boxes
5. Pricing table moolahs
6. Testimonial boxes
7. Irresistible trial statements
8. One-time offer headline stoppers
9. Order steps explainio
10. Tic toc countdown timers
11. Compelling call to actions
12. Iron-clad guarantee seals
13. Special badges
14. Arrows, bullets, checkmarks
15. Social media icons
16. Moody background textures
17. Sales video skins
18. Trendy mobile squeeze pages
19. Facebook timeline covers
20. Ready-to-go banner ads
All of those components are in all set of graphic (PSD files included). All graphic
collections are ready-made, modern, latest, high quality which allow any Internet user
can copy-paste in a beautiful way to their sites
Graphics Empire Firesale Reviews
About Author
Authors of Graphics Empire are Keyte Lee and June Ashley, they design websites
and graphics for offline business clients, and also create ready-made graphic
solutions for online marketers.
As far as I know, they got into the Online Marketing space by “accident”, up until a
couple of years ago; they have been exclusively rendering our service for clients
from conventional businesses and events. Many times, they entertained the idea of
peddling their own graphic solutions. Then, their first ever graphics product was
chosen as Pick Of The Day on JVZoo.com. Since then they’ve created several other
graphic products – many of which became JVZoo bestsellers.
For this product, they and their team spend 2 months of hard-working to complete
the product.
Who Would Be Interested In Graphics Empire
Firesale?
• Graphic Designers
• Internet Marketers
• Resellers
• Small Business Owners
• Membership Owners
Why you should choose Graphic Empire Firesale?
All those graphics are up-to-date, modern and in line with the latest style of web
design today. Graphics also are ready to go and anyone who knows how to copy and
paste these graphics can use them. While you can use these images for your own
websites, they are also giving you the instant income opportunity in the form of
Private Label Rights. You will get our professional written sales letters and thank you
page, if you tried writing your own copy before then you will know this is a time-
consuming, brain –frying process. Easily put your name and order link, slap it up on
your website and you can be in business as early as today.
You also get our professionally made sales video. We seldom see this offered in
other business-in-a-box deals, with a sales video, you can potentially double or even
triple your sales. These entire reseller packages will be completed with all set of
graphics (PSD files included).
With the Private Label Rights to Graphics Empire, this is the easiest and the fastest
way you can make money selling your own product:
• You can put your name on the product as the author
• You can edit the contents, change the cover and re-title the package and its
modules
• You can resell Graphics Empire as it is – and remember you keep every sale
you make
• You can add to your paid memberships (where you’ve registered as paid
membership) to enhance your memberships value
• You can include Graphics Empire Filesale in a paid package and sell at a
higher price
• You can use it as a valuable bonus
• You can use it in trainings, seminars as promotion materials.
Graphics Empire Firesale price: Designing a complete thorough product like this
would have easily set you back by $1000s in professional outsource fees: for
graphics products, for sales copy (it was done by top gun copywriter Edmund Loh
who’s got a flair for salesmanship in print, he is the guy behinds the scenes on many
high profile launches – including one that grossed $420,000+ in sales. That’s not
mentioning how Private Label Rights to products sell at minimum 20 times the retail
price.
Understandably, not everyone has spare thousand dollars laying around. Our
intention is to have more people afford it. Because if you build your business
successfully in the graphics niche, you will come back with them, and they can find a
partner in you for our future graphic offers.
Special notes and bonus: This Firesale runs for only 7 days (March 22 @ 11:00AM to
29th March @ 11:59PM EST) with some special bonuses they prepared for this event.
You will agree with me, this is absolutely, ridiculously crazy deal
Restriction: Under no circumstances is Graphic Empire meant to be given away for
FREE
Refundable: Graphics Empire Firesale is refundable within 30 days, if you are not
satisfied with the product, you can get your money back.
Why you should buy Graphics Empire Firesale
here?
On this site only, we prepared for you some extra special bonuses. All of those
bonuses are related to the main product – Graphics Empire Firesale, so hopefully
they will help you develop your business.
Bonus 1: Graphics Blackbox 3
Graphics Blackbox 3: Flat Edition.
Break all the rules in graphic design.
Get more sales + command more fees + make more money using flat design in your
marketing pages.
Brand new ready to use graphics.
Source file included, quick to customize.
Massive package of flat design elements.
Easy to use and integrate to your sales page
Price $9.95, for you: free
Bonus 2: Ecover Graphics Giant
Instantly boost your sales and credibility with over 100 new high impact ecover graphic
templates.
Get 25 unique ecover graphic templates (total 125 variations).
Turn 2D ecover templates into 3d graphics in seconds.
Hassle free 1 minute customization (no Photoshop needed).
Looks click & professional.
Instant trust & credibility booster.
Price: $9, for you: free
Bonus 3: Hydra Graphics Package
Get instant access to 38 eye popping, ready made logos you can use for your next product
or business.
Simple choose a logo and customise.
38 professionally-designed logos in 7 hot industries – Business, Fitness, Health, Money,
Real Estate, Self improvement, Technology & Computers.
All logos are about 800 pixels wide – large enough for using on eCovers, websites, print
shirts and more.
All the fonts used in the logos are also included.
Price: $27, for you: free
Bonus 4: Marketing Graphics Toolkit V4
Grab the ultimate collection of 30 different modules of premium graphics tools and
templates.
This is a must have for every Internet Marketer because sooner or later you need this.
Price: $19.95, for you: free
3 steps to claim this bonuses:
• Get Graphics Empire Firesale by Clicking here to buy it now
• After completing the transaction, foward the receipt to our email at :
contact@graphicsempirefiresalereviews.com
• You will receive the bonus within 12 hours
To buy Graphics Empire Firesale from our site:
Conclusion
Originally, they plan to sell these graphics with personal usage license only (which is
what they have done with all of our products before). After that, they decided to give
you the Private Label Rights license to further rebrand and edit this package as you
see fit. You’re now looking at the Ultimate business-in-a-box to get you jumpstarted
in a brand new, evergreen niche.
How would you like to get started in an exciting, evergreen niche site where almost
everyone with a business of any kind is your potential customer? We all know that
this kind of niche is so profitable and it is very hard to fail!
You don’t have to do any market research!
You don’t have to do any product or write a single word!
Because everything is already done for you, you can start racking and sell as early as
today!
And the best part is you can keep all the profits without having to share a cent with
them! Furthermore, they will even let you put your name and brand on this ready-to-
go business. If this sounds exciting to you, they invite you to check out this amazing
opportunity which have prepared only for a limited number of people and for a
limited time only
Graphics Empire Firesale Reviews
March 15, 2015 by admin Leave a Comment (Edit)
Graphics Empire Firesale
How does It Work?
Graphics Empire Firesale is one of the perfect tools that you can use to boost your business
online. This will help you to gain more profit. You can sell this product as your own.
Graphics Empire Firesale will help you to boost conversation and increase your sales online
fast. It is considered as one of the best tools that are effective these days.
Target Audiences of Graphics Empire Firesale
• Reseller
• Internet marketer
• Membership owners
• Graphic designer
• Small business owners
Design graphics for online business
It is a license deals for every business graphics. Marketers need their sites to become more
updated. They want to keep their business images to succeed on their online campaign.
This package include design in this is a graphic collection. If you are a busy business owner
this program will help you to create an effective program. This will give more chances to
earn more profit online. These is a unique and an exceptional graphics that will help
businesses to take graphics that will give them more information to become more
competitive in the world of business. The quality of your graphics will help you to succeed or
to fail. This graphics empire will give you the permission to use the graphics or you can
make this as a guide to make your graphics. If you want to continue using this graphics
empire you will be able to pay money to continue using the graphics
About Author
June Ashley and Kayte Lee they are a producer, author, fashion designer and a
businesswoman. Aside from that they are a designer of website and graphics offline
business clients, and they also created the ready-made graphic solution for online
marketers. For many years they are exclusively rendering services for clients from events
and conventional businesses. They have created first graphic product which have chosen in
the pick of the day on JVZoo as bestseller.
Advantage
The graphics are up-to-date and modern having with the latest design of the web today.
You can use this your business or to your website to have more opportunity to earn instant
income. This will help those business online to generate more income as we all know that
graphics have more impact on potential customers than text do.
1. High impact headlines
2. Sexy feature boxes
3. Customizable sales funnel diagrams
4. Fast action bonus boxes
5. Pricing table moolahs
6. Testimonial boxes
7. Irresistible trial statements
8. One-time offer headline stoppers
9. Order steps explainio
10. Tic toc countdown timers
11. Compelling call to actions
12. Iron-clad guarantee seals
13. Special badges
14. Arrows, bullets, checkmarks
15. Social media icons
16. Moody background textures
17. Sales video skins
18. Trendy mobile squeeze pages
19. Facebook timeline covers
20. Ready-to-go banner ads
Disadvantages
In case you are an expert in graphics designer, it would be easy for you to design your own
graphic features, but you will agree with me that it takes time to design everything on your
own. If you need only one or two graphics for your site and you’re not willing to resell
Graphics Empire Firesale, you surely dont need this product right now.
As everyone has her own graphic style, some features of Graphics Empire may not fully
fullfil your desire because you don’t see them beautiful and suitable for your site. However
that would be fine because this product is fully refundable within 30 days, I think that’s
enough time for you to consider.
Conclusion
In order to gain more profit you can use this graphics empire for your business online this
would be the easiest way to make money by selling your own product. You will just put your
name on the product as the author. You will be able to edit the content and you can also
change the cover. You can resell the graphics empire as it is you keep every sale your
making. With Graphics Empire Firesale, it is certainly a top product that can help your
business to succeed online.
To buy Graphics Empire Firesale from our site:

Contenu connexe

En vedette

National Life IT Department's Cyber Security Awareness Presentation
National Life IT Department's Cyber Security Awareness PresentationNational Life IT Department's Cyber Security Awareness Presentation
National Life IT Department's Cyber Security Awareness PresentationJamie Proctor-Brassard
 
Cyber Security Awareness
Cyber Security AwarenessCyber Security Awareness
Cyber Security AwarenessRamiro Cid
 
Cybersecurity Risk Management for Financial Institutions
Cybersecurity Risk Management for Financial InstitutionsCybersecurity Risk Management for Financial Institutions
Cybersecurity Risk Management for Financial InstitutionsSarah Cirelli
 
Cyber security awareness
Cyber security awarenessCyber security awareness
Cyber security awarenessJason Murray
 
Using Cloud in an Enterprise Environment
Using Cloud in an Enterprise EnvironmentUsing Cloud in an Enterprise Environment
Using Cloud in an Enterprise EnvironmentMike Crabb
 
cyber terrorism
cyber terrorismcyber terrorism
cyber terrorismAccenture
 
Cyber Terrorism Presentation
Cyber Terrorism PresentationCyber Terrorism Presentation
Cyber Terrorism Presentationmerlyna
 
Hacking the Web
Hacking the WebHacking the Web
Hacking the WebMike Crabb
 
Cyber Wars And Cyber Terrorism
Cyber Wars And Cyber TerrorismCyber Wars And Cyber Terrorism
Cyber Wars And Cyber TerrorismGanesh DNP
 
Cyber security presentation
Cyber security presentationCyber security presentation
Cyber security presentationBijay Bhandari
 
Cyber Security - awareness, vulnerabilities and solutions
Cyber Security - awareness, vulnerabilities and solutionsCyber Security - awareness, vulnerabilities and solutions
Cyber Security - awareness, vulnerabilities and solutionsinLabFIB
 

En vedette (13)

National Life IT Department's Cyber Security Awareness Presentation
National Life IT Department's Cyber Security Awareness PresentationNational Life IT Department's Cyber Security Awareness Presentation
National Life IT Department's Cyber Security Awareness Presentation
 
Cyber Security Awareness
Cyber Security AwarenessCyber Security Awareness
Cyber Security Awareness
 
Cybersecurity Risk Management for Financial Institutions
Cybersecurity Risk Management for Financial InstitutionsCybersecurity Risk Management for Financial Institutions
Cybersecurity Risk Management for Financial Institutions
 
Cyber security awareness
Cyber security awarenessCyber security awareness
Cyber security awareness
 
Using Cloud in an Enterprise Environment
Using Cloud in an Enterprise EnvironmentUsing Cloud in an Enterprise Environment
Using Cloud in an Enterprise Environment
 
cyber terrorism
cyber terrorismcyber terrorism
cyber terrorism
 
Cyber Terrorism Presentation
Cyber Terrorism PresentationCyber Terrorism Presentation
Cyber Terrorism Presentation
 
Hacking the Web
Hacking the WebHacking the Web
Hacking the Web
 
Fire kills 1
Fire kills 1Fire kills 1
Fire kills 1
 
Cyber Wars And Cyber Terrorism
Cyber Wars And Cyber TerrorismCyber Wars And Cyber Terrorism
Cyber Wars And Cyber Terrorism
 
Cyber security presentation
Cyber security presentationCyber security presentation
Cyber security presentation
 
Cyber Security - awareness, vulnerabilities and solutions
Cyber Security - awareness, vulnerabilities and solutionsCyber Security - awareness, vulnerabilities and solutions
Cyber Security - awareness, vulnerabilities and solutions
 
CYBER TERRORISM
     CYBER TERRORISM     CYBER TERRORISM
CYBER TERRORISM
 

Dernier

Kurla Call Girls Pooja Nehwal📞 9892124323 ✅ Vashi Call Service Available Nea...
Kurla Call Girls Pooja Nehwal📞 9892124323 ✅  Vashi Call Service Available Nea...Kurla Call Girls Pooja Nehwal📞 9892124323 ✅  Vashi Call Service Available Nea...
Kurla Call Girls Pooja Nehwal📞 9892124323 ✅ Vashi Call Service Available Nea...Pooja Nehwal
 
(AISHA) Ambegaon Khurd Call Girls Just Call 7001035870 [ Cash on Delivery ] P...
(AISHA) Ambegaon Khurd Call Girls Just Call 7001035870 [ Cash on Delivery ] P...(AISHA) Ambegaon Khurd Call Girls Just Call 7001035870 [ Cash on Delivery ] P...
(AISHA) Ambegaon Khurd Call Girls Just Call 7001035870 [ Cash on Delivery ] P...ranjana rawat
 
SD_The MATATAG Curriculum Training Design.pptx
SD_The MATATAG Curriculum Training Design.pptxSD_The MATATAG Curriculum Training Design.pptx
SD_The MATATAG Curriculum Training Design.pptxjanettecruzeiro1
 
VIP Call Girls Service Mehdipatnam Hyderabad Call +91-8250192130
VIP Call Girls Service Mehdipatnam Hyderabad Call +91-8250192130VIP Call Girls Service Mehdipatnam Hyderabad Call +91-8250192130
VIP Call Girls Service Mehdipatnam Hyderabad Call +91-8250192130Suhani Kapoor
 
WAEC Carpentry and Joinery Past Questions
WAEC Carpentry and Joinery Past QuestionsWAEC Carpentry and Joinery Past Questions
WAEC Carpentry and Joinery Past QuestionsCharles Obaleagbon
 
Fashion trends before and after covid.pptx
Fashion trends before and after covid.pptxFashion trends before and after covid.pptx
Fashion trends before and after covid.pptxVanshNarang19
 
Best VIP Call Girls Noida Sector 44 Call Me: 8448380779
Best VIP Call Girls Noida Sector 44 Call Me: 8448380779Best VIP Call Girls Noida Sector 44 Call Me: 8448380779
Best VIP Call Girls Noida Sector 44 Call Me: 8448380779Delhi Call girls
 
VIP Call Girls Service Kukatpally Hyderabad Call +91-8250192130
VIP Call Girls Service Kukatpally Hyderabad Call +91-8250192130VIP Call Girls Service Kukatpally Hyderabad Call +91-8250192130
VIP Call Girls Service Kukatpally Hyderabad Call +91-8250192130Suhani Kapoor
 
VVIP Pune Call Girls Dange Chowk (8250192130) Pune Escorts Nearby with Comple...
VVIP Pune Call Girls Dange Chowk (8250192130) Pune Escorts Nearby with Comple...VVIP Pune Call Girls Dange Chowk (8250192130) Pune Escorts Nearby with Comple...
VVIP Pune Call Girls Dange Chowk (8250192130) Pune Escorts Nearby with Comple...Call Girls in Nagpur High Profile
 
Booking open Available Pune Call Girls Kirkatwadi 6297143586 Call Hot Indian...
Booking open Available Pune Call Girls Kirkatwadi  6297143586 Call Hot Indian...Booking open Available Pune Call Girls Kirkatwadi  6297143586 Call Hot Indian...
Booking open Available Pune Call Girls Kirkatwadi 6297143586 Call Hot Indian...Call Girls in Nagpur High Profile
 
Dubai Call Girls Pro Domain O525547819 Call Girls Dubai Doux
Dubai Call Girls Pro Domain O525547819 Call Girls Dubai DouxDubai Call Girls Pro Domain O525547819 Call Girls Dubai Doux
Dubai Call Girls Pro Domain O525547819 Call Girls Dubai Douxkojalkojal131
 
Pooja 9892124323, Call girls Services and Mumbai Escort Service Near Hotel Gi...
Pooja 9892124323, Call girls Services and Mumbai Escort Service Near Hotel Gi...Pooja 9892124323, Call girls Services and Mumbai Escort Service Near Hotel Gi...
Pooja 9892124323, Call girls Services and Mumbai Escort Service Near Hotel Gi...Pooja Nehwal
 
VVIP Pune Call Girls Hadapsar (7001035870) Pune Escorts Nearby with Complete ...
VVIP Pune Call Girls Hadapsar (7001035870) Pune Escorts Nearby with Complete ...VVIP Pune Call Girls Hadapsar (7001035870) Pune Escorts Nearby with Complete ...
VVIP Pune Call Girls Hadapsar (7001035870) Pune Escorts Nearby with Complete ...Call Girls in Nagpur High Profile
 
Top Rated Pune Call Girls Koregaon Park ⟟ 6297143586 ⟟ Call Me For Genuine S...
Top Rated  Pune Call Girls Koregaon Park ⟟ 6297143586 ⟟ Call Me For Genuine S...Top Rated  Pune Call Girls Koregaon Park ⟟ 6297143586 ⟟ Call Me For Genuine S...
Top Rated Pune Call Girls Koregaon Park ⟟ 6297143586 ⟟ Call Me For Genuine S...Call Girls in Nagpur High Profile
 
The Art of Batik, template ppt aesthetic
The Art of Batik, template ppt aestheticThe Art of Batik, template ppt aesthetic
The Art of Batik, template ppt aestheticTiaFebriani
 
DragonBall PowerPoint Template for demo.pptx
DragonBall PowerPoint Template for demo.pptxDragonBall PowerPoint Template for demo.pptx
DragonBall PowerPoint Template for demo.pptxmirandajeremy200221
 
Call Girls in Kalkaji Delhi 8264348440 call girls ❤️
Call Girls in Kalkaji Delhi 8264348440 call girls ❤️Call Girls in Kalkaji Delhi 8264348440 call girls ❤️
Call Girls in Kalkaji Delhi 8264348440 call girls ❤️soniya singh
 
Booking open Available Pune Call Girls Nanded City 6297143586 Call Hot India...
Booking open Available Pune Call Girls Nanded City  6297143586 Call Hot India...Booking open Available Pune Call Girls Nanded City  6297143586 Call Hot India...
Booking open Available Pune Call Girls Nanded City 6297143586 Call Hot India...Call Girls in Nagpur High Profile
 
Top Rated Pune Call Girls Saswad ⟟ 6297143586 ⟟ Call Me For Genuine Sex Serv...
Top Rated  Pune Call Girls Saswad ⟟ 6297143586 ⟟ Call Me For Genuine Sex Serv...Top Rated  Pune Call Girls Saswad ⟟ 6297143586 ⟟ Call Me For Genuine Sex Serv...
Top Rated Pune Call Girls Saswad ⟟ 6297143586 ⟟ Call Me For Genuine Sex Serv...Call Girls in Nagpur High Profile
 

Dernier (20)

Kurla Call Girls Pooja Nehwal📞 9892124323 ✅ Vashi Call Service Available Nea...
Kurla Call Girls Pooja Nehwal📞 9892124323 ✅  Vashi Call Service Available Nea...Kurla Call Girls Pooja Nehwal📞 9892124323 ✅  Vashi Call Service Available Nea...
Kurla Call Girls Pooja Nehwal📞 9892124323 ✅ Vashi Call Service Available Nea...
 
(AISHA) Ambegaon Khurd Call Girls Just Call 7001035870 [ Cash on Delivery ] P...
(AISHA) Ambegaon Khurd Call Girls Just Call 7001035870 [ Cash on Delivery ] P...(AISHA) Ambegaon Khurd Call Girls Just Call 7001035870 [ Cash on Delivery ] P...
(AISHA) Ambegaon Khurd Call Girls Just Call 7001035870 [ Cash on Delivery ] P...
 
SD_The MATATAG Curriculum Training Design.pptx
SD_The MATATAG Curriculum Training Design.pptxSD_The MATATAG Curriculum Training Design.pptx
SD_The MATATAG Curriculum Training Design.pptx
 
VIP Call Girls Service Mehdipatnam Hyderabad Call +91-8250192130
VIP Call Girls Service Mehdipatnam Hyderabad Call +91-8250192130VIP Call Girls Service Mehdipatnam Hyderabad Call +91-8250192130
VIP Call Girls Service Mehdipatnam Hyderabad Call +91-8250192130
 
WAEC Carpentry and Joinery Past Questions
WAEC Carpentry and Joinery Past QuestionsWAEC Carpentry and Joinery Past Questions
WAEC Carpentry and Joinery Past Questions
 
Fashion trends before and after covid.pptx
Fashion trends before and after covid.pptxFashion trends before and after covid.pptx
Fashion trends before and after covid.pptx
 
Best VIP Call Girls Noida Sector 44 Call Me: 8448380779
Best VIP Call Girls Noida Sector 44 Call Me: 8448380779Best VIP Call Girls Noida Sector 44 Call Me: 8448380779
Best VIP Call Girls Noida Sector 44 Call Me: 8448380779
 
VIP Call Girls Service Kukatpally Hyderabad Call +91-8250192130
VIP Call Girls Service Kukatpally Hyderabad Call +91-8250192130VIP Call Girls Service Kukatpally Hyderabad Call +91-8250192130
VIP Call Girls Service Kukatpally Hyderabad Call +91-8250192130
 
VVIP Pune Call Girls Dange Chowk (8250192130) Pune Escorts Nearby with Comple...
VVIP Pune Call Girls Dange Chowk (8250192130) Pune Escorts Nearby with Comple...VVIP Pune Call Girls Dange Chowk (8250192130) Pune Escorts Nearby with Comple...
VVIP Pune Call Girls Dange Chowk (8250192130) Pune Escorts Nearby with Comple...
 
Booking open Available Pune Call Girls Kirkatwadi 6297143586 Call Hot Indian...
Booking open Available Pune Call Girls Kirkatwadi  6297143586 Call Hot Indian...Booking open Available Pune Call Girls Kirkatwadi  6297143586 Call Hot Indian...
Booking open Available Pune Call Girls Kirkatwadi 6297143586 Call Hot Indian...
 
Dubai Call Girls Pro Domain O525547819 Call Girls Dubai Doux
Dubai Call Girls Pro Domain O525547819 Call Girls Dubai DouxDubai Call Girls Pro Domain O525547819 Call Girls Dubai Doux
Dubai Call Girls Pro Domain O525547819 Call Girls Dubai Doux
 
Pooja 9892124323, Call girls Services and Mumbai Escort Service Near Hotel Gi...
Pooja 9892124323, Call girls Services and Mumbai Escort Service Near Hotel Gi...Pooja 9892124323, Call girls Services and Mumbai Escort Service Near Hotel Gi...
Pooja 9892124323, Call girls Services and Mumbai Escort Service Near Hotel Gi...
 
VVIP Pune Call Girls Hadapsar (7001035870) Pune Escorts Nearby with Complete ...
VVIP Pune Call Girls Hadapsar (7001035870) Pune Escorts Nearby with Complete ...VVIP Pune Call Girls Hadapsar (7001035870) Pune Escorts Nearby with Complete ...
VVIP Pune Call Girls Hadapsar (7001035870) Pune Escorts Nearby with Complete ...
 
Top Rated Pune Call Girls Koregaon Park ⟟ 6297143586 ⟟ Call Me For Genuine S...
Top Rated  Pune Call Girls Koregaon Park ⟟ 6297143586 ⟟ Call Me For Genuine S...Top Rated  Pune Call Girls Koregaon Park ⟟ 6297143586 ⟟ Call Me For Genuine S...
Top Rated Pune Call Girls Koregaon Park ⟟ 6297143586 ⟟ Call Me For Genuine S...
 
young call girls in Vivek Vihar🔝 9953056974 🔝 Delhi escort Service
young call girls in Vivek Vihar🔝 9953056974 🔝 Delhi escort Serviceyoung call girls in Vivek Vihar🔝 9953056974 🔝 Delhi escort Service
young call girls in Vivek Vihar🔝 9953056974 🔝 Delhi escort Service
 
The Art of Batik, template ppt aesthetic
The Art of Batik, template ppt aestheticThe Art of Batik, template ppt aesthetic
The Art of Batik, template ppt aesthetic
 
DragonBall PowerPoint Template for demo.pptx
DragonBall PowerPoint Template for demo.pptxDragonBall PowerPoint Template for demo.pptx
DragonBall PowerPoint Template for demo.pptx
 
Call Girls in Kalkaji Delhi 8264348440 call girls ❤️
Call Girls in Kalkaji Delhi 8264348440 call girls ❤️Call Girls in Kalkaji Delhi 8264348440 call girls ❤️
Call Girls in Kalkaji Delhi 8264348440 call girls ❤️
 
Booking open Available Pune Call Girls Nanded City 6297143586 Call Hot India...
Booking open Available Pune Call Girls Nanded City  6297143586 Call Hot India...Booking open Available Pune Call Girls Nanded City  6297143586 Call Hot India...
Booking open Available Pune Call Girls Nanded City 6297143586 Call Hot India...
 
Top Rated Pune Call Girls Saswad ⟟ 6297143586 ⟟ Call Me For Genuine Sex Serv...
Top Rated  Pune Call Girls Saswad ⟟ 6297143586 ⟟ Call Me For Genuine Sex Serv...Top Rated  Pune Call Girls Saswad ⟟ 6297143586 ⟟ Call Me For Genuine Sex Serv...
Top Rated Pune Call Girls Saswad ⟟ 6297143586 ⟟ Call Me For Genuine Sex Serv...
 

Graphics empire firesale

  • 1. Graphics Empire Firesale What is Graphics Empire Firesale? It’s all about selling graphics product that can be used in business success this is a special that can be used by business marketers and resellers to get the highest profit ever. In the world of marketing,there are different kinds of graphics that you can use in your marketing business to make it more profitable. To gain more traffic in your online business you can use professional cover images. You can also send conversation and sales. Obtain the best web graphics for direct sales mini site. Creating good graphics design on your sales can easily increase your sales. You can also apply business icons, websites graphics as well as sales clipart collection. It is a brand new Graphics business-in-a-box package that marketers and resellers can use easily for their sites. The main components of Graphics Empire include: • 20 Graphics Modules • Sales Letter & TQ Page • Sales Video • Graphics • Non-Transferable PLR License 20 main graphics modules are listed below: 1. High impact headlines 2. Sexy feature boxes 3. Customizable sales funnel diagrams 4. Fast action bonus boxes 5. Pricing table moolahs 6. Testimonial boxes
  • 2. 7. Irresistible trial statements 8. One-time offer headline stoppers 9. Order steps explainio 10. Tic toc countdown timers 11. Compelling call to actions 12. Iron-clad guarantee seals 13. Special badges 14. Arrows, bullets, checkmarks 15. Social media icons 16. Moody background textures 17. Sales video skins 18. Trendy mobile squeeze pages 19. Facebook timeline covers 20. Ready-to-go banner ads All of those components are in all set of graphic (PSD files included). All graphic collections are ready-made, modern, latest, high quality which allow any Internet user can copy-paste in a beautiful way to their sites
  • 3. Graphics Empire Firesale Reviews About Author Authors of Graphics Empire are Keyte Lee and June Ashley, they design websites and graphics for offline business clients, and also create ready-made graphic solutions for online marketers. As far as I know, they got into the Online Marketing space by “accident”, up until a couple of years ago; they have been exclusively rendering our service for clients from conventional businesses and events. Many times, they entertained the idea of peddling their own graphic solutions. Then, their first ever graphics product was chosen as Pick Of The Day on JVZoo.com. Since then they’ve created several other graphic products – many of which became JVZoo bestsellers. For this product, they and their team spend 2 months of hard-working to complete the product. Who Would Be Interested In Graphics Empire Firesale? • Graphic Designers • Internet Marketers • Resellers
  • 4. • Small Business Owners • Membership Owners Why you should choose Graphic Empire Firesale? All those graphics are up-to-date, modern and in line with the latest style of web design today. Graphics also are ready to go and anyone who knows how to copy and paste these graphics can use them. While you can use these images for your own websites, they are also giving you the instant income opportunity in the form of Private Label Rights. You will get our professional written sales letters and thank you page, if you tried writing your own copy before then you will know this is a time- consuming, brain –frying process. Easily put your name and order link, slap it up on your website and you can be in business as early as today. You also get our professionally made sales video. We seldom see this offered in other business-in-a-box deals, with a sales video, you can potentially double or even triple your sales. These entire reseller packages will be completed with all set of graphics (PSD files included). With the Private Label Rights to Graphics Empire, this is the easiest and the fastest way you can make money selling your own product: • You can put your name on the product as the author • You can edit the contents, change the cover and re-title the package and its modules • You can resell Graphics Empire as it is – and remember you keep every sale you make • You can add to your paid memberships (where you’ve registered as paid membership) to enhance your memberships value • You can include Graphics Empire Filesale in a paid package and sell at a higher price • You can use it as a valuable bonus
  • 5. • You can use it in trainings, seminars as promotion materials. Graphics Empire Firesale price: Designing a complete thorough product like this would have easily set you back by $1000s in professional outsource fees: for graphics products, for sales copy (it was done by top gun copywriter Edmund Loh who’s got a flair for salesmanship in print, he is the guy behinds the scenes on many high profile launches – including one that grossed $420,000+ in sales. That’s not mentioning how Private Label Rights to products sell at minimum 20 times the retail price. Understandably, not everyone has spare thousand dollars laying around. Our intention is to have more people afford it. Because if you build your business successfully in the graphics niche, you will come back with them, and they can find a partner in you for our future graphic offers. Special notes and bonus: This Firesale runs for only 7 days (March 22 @ 11:00AM to 29th March @ 11:59PM EST) with some special bonuses they prepared for this event. You will agree with me, this is absolutely, ridiculously crazy deal Restriction: Under no circumstances is Graphic Empire meant to be given away for FREE Refundable: Graphics Empire Firesale is refundable within 30 days, if you are not satisfied with the product, you can get your money back. Why you should buy Graphics Empire Firesale here? On this site only, we prepared for you some extra special bonuses. All of those bonuses are related to the main product – Graphics Empire Firesale, so hopefully they will help you develop your business. Bonus 1: Graphics Blackbox 3
  • 6. Graphics Blackbox 3: Flat Edition. Break all the rules in graphic design. Get more sales + command more fees + make more money using flat design in your marketing pages. Brand new ready to use graphics. Source file included, quick to customize. Massive package of flat design elements. Easy to use and integrate to your sales page Price $9.95, for you: free Bonus 2: Ecover Graphics Giant
  • 7. Instantly boost your sales and credibility with over 100 new high impact ecover graphic templates. Get 25 unique ecover graphic templates (total 125 variations). Turn 2D ecover templates into 3d graphics in seconds. Hassle free 1 minute customization (no Photoshop needed). Looks click & professional. Instant trust & credibility booster. Price: $9, for you: free Bonus 3: Hydra Graphics Package
  • 8. Get instant access to 38 eye popping, ready made logos you can use for your next product or business. Simple choose a logo and customise. 38 professionally-designed logos in 7 hot industries – Business, Fitness, Health, Money, Real Estate, Self improvement, Technology & Computers. All logos are about 800 pixels wide – large enough for using on eCovers, websites, print shirts and more. All the fonts used in the logos are also included. Price: $27, for you: free Bonus 4: Marketing Graphics Toolkit V4 Grab the ultimate collection of 30 different modules of premium graphics tools and templates.
  • 9. This is a must have for every Internet Marketer because sooner or later you need this. Price: $19.95, for you: free 3 steps to claim this bonuses: • Get Graphics Empire Firesale by Clicking here to buy it now • After completing the transaction, foward the receipt to our email at : contact@graphicsempirefiresalereviews.com • You will receive the bonus within 12 hours To buy Graphics Empire Firesale from our site: Conclusion Originally, they plan to sell these graphics with personal usage license only (which is what they have done with all of our products before). After that, they decided to give you the Private Label Rights license to further rebrand and edit this package as you see fit. You’re now looking at the Ultimate business-in-a-box to get you jumpstarted in a brand new, evergreen niche. How would you like to get started in an exciting, evergreen niche site where almost everyone with a business of any kind is your potential customer? We all know that this kind of niche is so profitable and it is very hard to fail! You don’t have to do any market research! You don’t have to do any product or write a single word! Because everything is already done for you, you can start racking and sell as early as today!
  • 10. And the best part is you can keep all the profits without having to share a cent with them! Furthermore, they will even let you put your name and brand on this ready-to- go business. If this sounds exciting to you, they invite you to check out this amazing opportunity which have prepared only for a limited number of people and for a limited time only Graphics Empire Firesale Reviews March 15, 2015 by admin Leave a Comment (Edit) Graphics Empire Firesale How does It Work? Graphics Empire Firesale is one of the perfect tools that you can use to boost your business online. This will help you to gain more profit. You can sell this product as your own. Graphics Empire Firesale will help you to boost conversation and increase your sales online fast. It is considered as one of the best tools that are effective these days. Target Audiences of Graphics Empire Firesale • Reseller • Internet marketer • Membership owners • Graphic designer • Small business owners Design graphics for online business It is a license deals for every business graphics. Marketers need their sites to become more updated. They want to keep their business images to succeed on their online campaign. This package include design in this is a graphic collection. If you are a busy business owner
  • 11. this program will help you to create an effective program. This will give more chances to earn more profit online. These is a unique and an exceptional graphics that will help businesses to take graphics that will give them more information to become more competitive in the world of business. The quality of your graphics will help you to succeed or to fail. This graphics empire will give you the permission to use the graphics or you can make this as a guide to make your graphics. If you want to continue using this graphics empire you will be able to pay money to continue using the graphics About Author June Ashley and Kayte Lee they are a producer, author, fashion designer and a businesswoman. Aside from that they are a designer of website and graphics offline business clients, and they also created the ready-made graphic solution for online marketers. For many years they are exclusively rendering services for clients from events and conventional businesses. They have created first graphic product which have chosen in the pick of the day on JVZoo as bestseller. Advantage The graphics are up-to-date and modern having with the latest design of the web today. You can use this your business or to your website to have more opportunity to earn instant income. This will help those business online to generate more income as we all know that graphics have more impact on potential customers than text do. 1. High impact headlines 2. Sexy feature boxes 3. Customizable sales funnel diagrams 4. Fast action bonus boxes 5. Pricing table moolahs 6. Testimonial boxes 7. Irresistible trial statements 8. One-time offer headline stoppers
  • 12. 9. Order steps explainio 10. Tic toc countdown timers 11. Compelling call to actions 12. Iron-clad guarantee seals 13. Special badges 14. Arrows, bullets, checkmarks 15. Social media icons 16. Moody background textures 17. Sales video skins 18. Trendy mobile squeeze pages 19. Facebook timeline covers 20. Ready-to-go banner ads Disadvantages In case you are an expert in graphics designer, it would be easy for you to design your own graphic features, but you will agree with me that it takes time to design everything on your own. If you need only one or two graphics for your site and you’re not willing to resell Graphics Empire Firesale, you surely dont need this product right now. As everyone has her own graphic style, some features of Graphics Empire may not fully fullfil your desire because you don’t see them beautiful and suitable for your site. However that would be fine because this product is fully refundable within 30 days, I think that’s enough time for you to consider. Conclusion In order to gain more profit you can use this graphics empire for your business online this would be the easiest way to make money by selling your own product. You will just put your name on the product as the author. You will be able to edit the content and you can also
  • 13. change the cover. You can resell the graphics empire as it is you keep every sale your making. With Graphics Empire Firesale, it is certainly a top product that can help your business to succeed online. To buy Graphics Empire Firesale from our site: