Ce diaporama a bien été signalé.
Nous utilisons votre profil LinkedIn et vos données d’activité pour vous proposer des publicités personnalisées et pertinentes. Vous pouvez changer vos préférences de publicités à tout moment.

GATE Biotechnology 2015 Original Questions Paper Part 1 (20 questions)

GATE Biotechnology (BT) Previous year Question Papers, GATE BT 2015 Download as PDF by easybiologyclass. GATE Biotechnology Previous Year Question Papers with Answer Key

  • Identifiez-vous pour voir les commentaires

GATE Biotechnology 2015 Original Questions Paper Part 1 (20 questions)

  1. 1. GATE Biotechnology (BT)‐2015 Save paper… Save trees… For more Questions and Resources for your CSIR/ICMR/DBT/ICAR/GATE/UGC/JRF NET Life Science Examination please visit: www.easybiologyclass.com 1 GATE Biotechnology (BT) 2015 (Graduate Aptitude Test in Engineering: Original Question Paper) Original Question Paper (Part 1: Question 1 – 20) 1. Which one of the following complement proteins is the initiator of the membrane attack complex? a. C3a b. C3b c. C5a d. C5b 2. Levinthal’s paradox is related to a. Protein secretion b. Protein degradation c. Protein folding d. Protein trafficking 3. Which one of the following is a second generation genetically engineered crop? a. Bt brinjal b. Roundup soyabean c. Golden rice d. Bt rice 4. Based on the heavy chain, which one of the following antibodies has multiple subtypes? a. IgM b. IgD c. IgE d. IgG 5. The cytokinesis organelle in plant cells is__ a. Centriole b. Phragmoplast c. Proplastid d. Chromoplastid 6. Anergy refers to: a. Mitochondrial dysfunction b. Allergy to environmental antigens c. Unresponsiveness to antigens d. A state of no energy w w w .easybiologyclass.com
  2. 2. GATE Biotechnology (BT)‐2015 Save paper… Save trees…   For more Questions and Resources for your CSIR/ICMR/DBT/ICAR/GATE/UGC/JRF NET Life Science Examination please visit: www.easybiologyclass.com 2   7. ABO blood group antigens in human are differentiated from each other on the basis of: a. Sialic acid b. Lipids c. Spectrin d. Glycoproteins 8. Which of the following organisms is used for the determination of phenol co‐ efficient of a disinfectant? a. Salmonella typhi b. Escherichia coli c. Candida albicans d. Bacillus psychrophilus 9. A single subunit enzyme converts 420 µmoles of substrate to product in one minute. The activity of the enzyme is ______ X 10‐6 Katal. a. 5 b. 6 c. 7 d. 8 10. Which of the following amino acids has the highest probability to be found on the surface of a typical globular protein in aqueous environment? a. Ala b. Val c. Arg d. Ille 11. Which one of the following is NOT a product of de‐nitrification in Pseudomonas? a. N2 b. N2O c. NO2 ‐ d. NH4 + 12. Which of the following feature is NOT required in a prokaryotic expression vector? a. OriC b. Selection marker c. CMV promoter d. Ribosome binding site 13. Production of monoclonal antibodies by hybridoma technology requires: a. Splenocytes b. Osteocytes c. Hepatocytes w w w .easybiologyclass.com
  3. 3. GATE Biotechnology (BT)‐2015 Save paper… Save trees…   For more Questions and Resources for your CSIR/ICMR/DBT/ICAR/GATE/UGC/JRF NET Life Science Examination please visit: www.easybiologyclass.com 3   d. Thymocytes 14. Which of the following is INCORRECT about a typical apoptotic cell? a. Phosphatidylserine is presented on the outer cell surface b. Cytochrome c is released from mitochondria c. Mitochondrial membrane potential does not change d. Annexin‐V binds to the cell surface 15. Identify the file format given below >P1:JMFD ProteinX – Homo sapiens MKALTARQQEVFDLIRDHISRTLRQQGDWL a. GDE b. FASTA c. NBRF d. GCG 16. Which one of the following relations holds true for the specific growth rate (µ) of a microorganism in the death phase? a. µ = 0 b. µ < 0 c. µ = µmax d. 0 < µ < µmax 17. How many 3‐tuples are possible for the following amino acid sequence? (MADCMWDISEASE) a. 4 b. 5 c. 11 d. 12 18. How many different protein sequences of 100 residues can be generated using 20 standard amino acids? a. 10020 b. 100 X 20 c. 20100 d. 100! X 20! 19. In DNA sequencing reactions using the chain termination method, the ratio of ddNTPs to dNTPs should be a. 0 b. < 1 c. 1 d. > 1 w w w .easybiologyclass.com
  4. 4. GATE Biotechnology (BT)‐2015 Save paper… Save trees…   For more Questions and Resources for your CSIR/ICMR/DBT/ICAR/GATE/UGC/JRF NET Life Science Examination please visit: www.easybiologyclass.com 4   20. Which of the following graph represent uncompetitive inhibition? a. Graph A b. Graph B c. Graph C d. Graph D ******************************* For correct answers and explanations visit http://www.easybiologyclass.com       w w w .easybiologyclass.com

×