SlideShare une entreprise Scribd logo
1  sur  42
Towards successful, and sustainable,
livestock futures worldwide
Borlaug distinguished lecture
Texas A&M University, 3 March 2015
Jimmy Smith  Director General  ILRI
The global livestock sector:
Changes ahead
40% of agricultural GDP and growing
4of5highest valueglobal commodities arelivestock
FAOSTAT 2014
(values for 2012)
0
200
400
600
800
1000
1200
1400
1600
1800
2000
0
20
40
60
80
100
120
140
160
180
200
Production(MT)millions
Netproductionvalue(Int$)billion
net production value (Int $) billion production (MT)
Cow milk has
overtaken rice
Eggs have
displaced
maize
Per capita global kilocalorie
availability from edible animal products
Source: Herrero et al (PNAS, in press)
Gains in meat consumption in developing
countries are outpacing those of developed
0
100
200
300
400
500
600
700
800
1980 1990 2002 2015 2030 2050
Millionmetrictonnes
developing countries
developed countries
Hypothetical: If
developing-country
per capita
consumption rate
equalled that of
developed countries
Milk demand and consumption levels
differ in developed and developing countries
0
100
200
300
400
500
600
700
800
900
1000
2005/07 2050
Demand for milk
million t/annum
Developing
Developed
0
50
100
150
200
250
2005/07 2050
Milk consumption
kg/capita/annum
Developed
Developing
Rising demand for meat,
milk and eggs is a global
phenomenon . . .
. . . but demand is
greatest in South Asia
and Sub-Saharan Africa
FAO 2012Based on anticipated change in absolute tonnes of product comparing 2000 and 2030
Percentage growth in demand
for livestock products: 2000−2030
Huge increases over 2005/7 amounts
of cereals, dairy and meat will be needed by 2050
From 2bn−3bn
tonnes cereals each year
From 664m−1bn
tonnes dairy each year
From 258m−460m
tonnes meat each year
The global livestock sector:
Opportunities
and challenges
Opportunities: Why
The demographics of demand
and supply open new,
unprecedented, opportunities:
• To enable smallholders to
continue to play central roles
in food and nutritional security
• To transform livelihoods
and rural economies
in developing countries
• To make animal agriculture
more environmentally
sustainable
Opportunities: Who
• 90% of animal products are
produced & consumed
in same country or region
• Most are produced
by smallholders
• More than 70% of livestock
products are sold informally
• 500m smallholders produce
80% of developing-world
food
• 43% of the agricultural
workforce is female
BMGF, FAO, ILRI
Smallholders still dominate
livestock production in many countries
Region
(definition of
‘smallholder’)
% production by smallholder livestock farms
Beef Chicken
meat
Sheep/goat
meat
Milk Pork Eggs
East Africa
(≤ 6 milking
animals)
60-90
Bangladesh
(< 3ha land)
65 77 78 65 77
India
(< 2ha land)
75 92 92 69 71
Vietnam
(small scale)
80
Philippines
(backyard)
50 35
Opportunities: How
This rising demand for
animal-source foods
will be met − one way
or another
We can meet that
demand in economically
viable, sustainable,
equitable and healthy
ways that also reduce
poverty and hunger
This requires
proactive action
Demand for livestock commodities in developing
economies will be met – the only question is how
Scenario #1
Meeting livestock demand by
importing livestock products
Scenario #2
Meeting livestock demand by
importing livestock industrial production know-how
Scenario #3
Meeting livestock demand by
transforming smallholder livestock systems
Scenario #3 is good news for
rural economic transformation
Upsides of smallholder
transformation
• The coming livestock transitions
and consolidations can help
millions improve their food
production as well as health,
livelihoods and environments
• Of the world’s 1 billion smallholder
livestock producers, some:
﹣1/3 will find alternate livelihoods
﹣1/3 will succeed in the market
﹣1/3 could go either way
Responding:
Livestock research
for development
Trajectories of growth
• ‘Strong growth’
– Intensifying and increasingly market
oriented often transforming
smallholder systems
• ‘Fragile growth’
– Where remoteness, marginal land
resources or agro climatic vulnerability
restrict intensification
• ‘High growth with externalities’
(industrial)
– Intensified livestock systems with
diverse challenges including the
environment and human health
Trajectory
‘Strong growth’
Sector
Ruminant meat and
milk, esp. in SSA, India
− Pork in some regions
Issues
− Sustainable
productivity
- Market access and
food safety
− Zoonotic outbreaks
Opportunities
Novel approaches
spanning sustainable
productivity, markets,
institutional and policy
issues, risk analyses
‘Fragile growth’ Some smallholder and
pastoral systems; little
part in the production
response
− Multiple endemic
diseases
− Zoonoses
− Adaptive capacity
− Movement controls
Mostly public sector
interventions, mitigating
vulnerability, improving
resilience
‘High growth
with
externalities’
Mostly monogastric
− China for all
commodities
− Environmental
- Drug resistance
− Climate impacts on
new vector and
pathogen dynamics
− Disease scares
Modalities of operation
with private sector
largely established.
Managing environment
and health risks and
consumer demand
Distinguishing opportunities
Research for development solutions
Food, equity,
environment, health
Policies, institutions
and markets
- Policy
development
- Foresight; trade
- Livestock value
chains
Sustainable livestock
systems
- Sustainable
intensification
- Climate change:
adaptation & mitigation
- System resilience
Feed resources
- Conservation &
use
- Feed production
- Feed utilization
Animal genetics and
breeding
- Gene discovery
- Genetic
improvement
- Breeding strategies
- conservation
Livestock – health
- Vaccines &
diagnostics
- Zoonoses; food
safety
- Herd health
Greatest burden of zoonoses falls on
one billion poor livestock keepers
Map by ILRI, from original in a report to DFID: Mapping of Poverty and Likely Zoonoses Hotspots, 2012
199
8
2007
African swine fever:
Threatens $150-billion global pig industry
Recent reports indicate ASF has moved into Belarus, Poland and Lithuania
Vaccines save lives of animals that both
increase food security and reduce poverty
ILVAC – a global vaccine initiative
An body technologies
Vaccine technologies
Cellular technologies
Diagnos c technologies
Genomic technologies
Contagiousbovine
pleuropneumonia
EastCoastfever
Africanswinefever
Consor a for research & product development and capacity development
Private sector
GALVmed
CRPs
NARS
Inter-gov
agencies
Improved vaccines and
diagnos c tools
Pestedespesruminants
RiValleyfever
Infec ous disease
research: basic & applied
ILVAC – a vaccine pla orm
ECF Consortium: Improved vaccines to control
lethal East Coast fever infections in cattle in Africa
Annual meeting, Addis Ababa, 9-11th February 2015
African swine fever: TAMU-ILRI planned research for
generating a subunit vaccine (funding still required)
• TAMU developed two candidate multivalent vaccines
• The vaccines are well tolerated by piglets & stimulate robust antibody & T-cell
responses in the animals
• Below left: The antibodies induced were shown to recognize the ASF virus
Studies to determine protective value of the vaccines is pending (Funding)
• Above right: Challenge with virulent Kenyan ASF virus to test
vaccine efficacy will be performed in ILRI BSL2 pig unit using
virulent Kenyan ASF virus isolated & characterized by ILRI
Food safety
• 90% of animal products are produced
and consumed in the same region
• Over 70% of livestock products
are sold ‘informally’
• There are major opportunities to
ensure that milk, meat and eggs are
safe for consumption (e.g. via
risk assessments and risk- rather
than rule-based regulations)
• ‘Intensifying’ livestock production
systems bring people and animals closer
together, increasing the threat of
zoonotic disease outbreaks and spread
ILRI–Texas collaboration:
Exporting live cattle and shoats and animal products: Ethiopia (2008)
• Risk from
properly handled
carcasses, meat
and meat products
is negligible
• Risk from
live cattle or shoats
introducing pathogens
of concern is important
LiveGene
Delivering improved genetics to the world’s small-scale livestock keepers
Targeting
Gene
Discovery
Delivering
Genetic Gains
Prioritizing
geography,
environment,
climate and social
change, traits,
species, breed.
Adaptive alleles,
characterization,
conservation,
Genome editing
Digital recording
platforms.
Phenotyping and
farmer feedback.
Integrated data – comms, bio-repository, phenotyping, feedback, bioinformatics.
Partnerships and networks
Capacity Development
New tools allow us to look in new places
for sources of variation – including wildlife
Comparative gene network
and sequence analysis
allows us to ask new kinds
of questions about genomes
– eg “what is different about
this (group of) species
compared to all other
“traditional” linkage mapping requires crosses – so initial discovery
is limited to variants within a species
Cow NDama KFITRRPSLKTLQEKGLIKDQIFGSPLHTLCEREKSTVPRFVKQCIEAVEK
Cow Boran KFITRRPSLKTLQEKGLIKDQIFGSHLHTLCEREKSTVPRFVKQCIEAVEK
Human KFISRRPSLKTLQEKGLIKDQIFGSHLHTVCEREHSTVPWFVKQCIEAVEK
Pig KFITRRPSLKTLQEKGLIKDQIFGSHLHTVCERENSTVPRFVKQCIEAVEK
Chicken KFISRRPSLKTLQEKGLIKDQIFGSHLHLVCEHENSTVPQFVRQCIKAVER
Salmon KFISRRPSMKTLQEKGIIKDRVFGCHLLALCEREGTTVPKFVRQCVEAVEK
Genotype data is relatively cheap and easy to obtain:
Phenotype data remains a challenge
Can we skip a generation of
technology?
• Fast, light, cheap
performance data
harvesting.
• Cheap sensors, mobile
platforms, crowd sensing…..
• Simultaneously providing
management information to
the farmer and
performance data to the
breeder.
Identify and deliver variants
associated with adaptation
Genotyping Phenotyping
Adapted &
productive
livestock
Genome
editing
Targeting
Data systems
Delivery
systems
• 70% of production cost – FEED
• 70% of feed – CROP RESIDUES
• Potential huge demand for grain for
MONOGASTRICS
• Opportunities:
– Improved crop residue
quantity and quality
– Improved use of crop residues
with other feed resources
– Balancing trade offs in biomass use
– Use of sorghum and other alternates
to maize for monogastrics
Research-based livestock feed successes
Feed opportunities
• Produce more and better quality
– Crop varieties with improved
residue quality/quantity
– Forages
• Better use available feed
– Via processing (chopping)
– Feed mixtures (rations)
• Import feed into the system
– From areas of surplus to deficit
– Concentrates
• Potential environmental ‘win-win’
ILRI–Texas collaborations in
livestock and environment issues
• Feed the Future Innovation Lab
for Small-scale Irrigation
- Exploring feed options
• Use of systems models
- Africa RISING
- LIVES
• Research evidence for
smallholder dairying included:
﹣Risk analysis of
informal milk marketing
﹣Employment and income
benefits for the poor
• Business/market development
links poor livestock producers
and feed suppliers to more
sophisticated input/output
systems
﹣A dairy ‘hub’ approach
has been widely adopted
Research-based livestock market successes
Global greenhouse gas efficiency
per kilogram of animal protein produced
Large livestock production inefficiencies
in the developing world present an opportunity
Herrero et al PNAS (in press)
GHG emissions to 2050 assuming developing
countries do NOT improve their efficiencies
0
2
4
6
8
10
12
2007 estimate 2050 estimate 2050 estimate
if all at
0.5l/day
GHG emissions GT CO2 eq per annum assuming
developed country levels remain at 1.3 kg/CO2 eq
per kg milk while developing countries remain at
7.5 kg/CO2 eq per kg milk
developing
developed
GHG emissions to 2050 assuming developing
countries DO improve their efficiencies
0
2
4
6
8
10
12
2007 estimate 2050 estimate 2050 estimate
if all at 0.5l/day
GHG emissions GT CO2 eq per annum
assuming both developed and developing country
levels are at 1.3 kg/CO2 eq per kg milk
developing
developed
Image credits
Slide cover:
(Left) Gond painting, 2012, by Kaushal Prasad Tekam (via Pinterest
(Middle) Untitled, by Kalam Patua (via Asia Art Archive)
(Right) Sacred cows, by Vidushini (via Novica)
Slide #11: Sacred cows, by Vidushini (via Novica)
Slide #12: Tingatinga painting (via InsideArtAfrica.com)
Slide #14: Untitled, by Kalam Patua (via Asia Art Archive)
Slide #16: Kalighat painting (via Pinterest)
The presentation has a Creative Commons licence. You are free to re-use or distribute this work, provided credit is
given to ILRI.
better lives through livestock
ilri.org
Thank you!
The presentation has a Creative Commons licence. You are free to re-use or distribute this work, provided credit is
given to ILRI.
better lives through livestock
ilri.org

Contenu connexe

Tendances

The role of livestock in achieving the SDGs
  The role of livestock in achieving the SDGs  The role of livestock in achieving the SDGs
The role of livestock in achieving the SDGsILRI
 
Antimicrobial use in developing countries
Antimicrobial use in developing countriesAntimicrobial use in developing countries
Antimicrobial use in developing countriesILRI
 
The global livestock sector: Trends, drivers and implications for society, he...
The global livestock sector: Trends, drivers and implications for society, he...The global livestock sector: Trends, drivers and implications for society, he...
The global livestock sector: Trends, drivers and implications for society, he...ILRI
 
Feeding research and feeding innovation
Feeding research and feeding innovationFeeding research and feeding innovation
Feeding research and feeding innovationILRI
 
The opportunities and challenges for livestock and aquaculture research for d...
The opportunities and challenges for livestock and aquaculture research for d...The opportunities and challenges for livestock and aquaculture research for d...
The opportunities and challenges for livestock and aquaculture research for d...GCARD Conferences
 
Innovative processing of cassava peels to livestock feeds—A collaborative pro...
Innovative processing of cassava peels to livestock feeds—A collaborative pro...Innovative processing of cassava peels to livestock feeds—A collaborative pro...
Innovative processing of cassava peels to livestock feeds—A collaborative pro...ILRI
 
ILRI overview
ILRI overviewILRI overview
ILRI overviewILRI
 
Livestock in the horn of Africa: An opportunity in waiting
Livestock in the horn of Africa: An opportunity in waiting Livestock in the horn of Africa: An opportunity in waiting
Livestock in the horn of Africa: An opportunity in waiting ILRI
 
African animal agriculture: Grasping opportunities
African animal agriculture: Grasping opportunitiesAfrican animal agriculture: Grasping opportunities
African animal agriculture: Grasping opportunitiesILRI
 
Climate change and animal health
Climate change and animal healthClimate change and animal health
Climate change and animal healthILRI
 
Achieving Agenda 2030: Livestock research and the transformation of small-sca...
Achieving Agenda 2030: Livestock research and the transformation of small-sca...Achieving Agenda 2030: Livestock research and the transformation of small-sca...
Achieving Agenda 2030: Livestock research and the transformation of small-sca...ILRI
 
Studies of zoonoses in dynamic livestock systems in Kenya
Studies of zoonoses in dynamic livestock systems in KenyaStudies of zoonoses in dynamic livestock systems in Kenya
Studies of zoonoses in dynamic livestock systems in KenyaILRI
 
Livestock: Opportunities for addressing global development challenges
Livestock: Opportunities for addressing global development challengesLivestock: Opportunities for addressing global development challenges
Livestock: Opportunities for addressing global development challengesILRI
 
Manure management policies: A supportive tool for saving the earth and improv...
Manure management policies: A supportive tool for saving the earth and improv...Manure management policies: A supportive tool for saving the earth and improv...
Manure management policies: A supportive tool for saving the earth and improv...ILRI
 
The role of informal food markets—Towards professionalizing, not criminalizing
The role of informal food markets—Towards professionalizing, not criminalizingThe role of informal food markets—Towards professionalizing, not criminalizing
The role of informal food markets—Towards professionalizing, not criminalizingILRI
 
Genomics selection in livestock: ILRI–ICARDA perspectives
Genomics selection in livestock: ILRI–ICARDA perspectivesGenomics selection in livestock: ILRI–ICARDA perspectives
Genomics selection in livestock: ILRI–ICARDA perspectivesILRI
 
Sustainable livestock insurance for pastoralists: From research to practice a...
Sustainable livestock insurance for pastoralists: From research to practice a...Sustainable livestock insurance for pastoralists: From research to practice a...
Sustainable livestock insurance for pastoralists: From research to practice a...ILRI
 
CGIAR Research Program on Agriculture for Improved Nutrition and Health
CGIAR Research Program on Agriculture for Improved Nutrition and HealthCGIAR Research Program on Agriculture for Improved Nutrition and Health
CGIAR Research Program on Agriculture for Improved Nutrition and HealthILRI
 
The emerging middle class and the world market for beef
The emerging middle class and  the world market for beefThe emerging middle class and  the world market for beef
The emerging middle class and the world market for beefILRI
 

Tendances (20)

The role of livestock in achieving the SDGs
  The role of livestock in achieving the SDGs  The role of livestock in achieving the SDGs
The role of livestock in achieving the SDGs
 
CRP portfolio 2017-2022 - Wayne Powell
CRP portfolio 2017-2022 - Wayne PowellCRP portfolio 2017-2022 - Wayne Powell
CRP portfolio 2017-2022 - Wayne Powell
 
Antimicrobial use in developing countries
Antimicrobial use in developing countriesAntimicrobial use in developing countries
Antimicrobial use in developing countries
 
The global livestock sector: Trends, drivers and implications for society, he...
The global livestock sector: Trends, drivers and implications for society, he...The global livestock sector: Trends, drivers and implications for society, he...
The global livestock sector: Trends, drivers and implications for society, he...
 
Feeding research and feeding innovation
Feeding research and feeding innovationFeeding research and feeding innovation
Feeding research and feeding innovation
 
The opportunities and challenges for livestock and aquaculture research for d...
The opportunities and challenges for livestock and aquaculture research for d...The opportunities and challenges for livestock and aquaculture research for d...
The opportunities and challenges for livestock and aquaculture research for d...
 
Innovative processing of cassava peels to livestock feeds—A collaborative pro...
Innovative processing of cassava peels to livestock feeds—A collaborative pro...Innovative processing of cassava peels to livestock feeds—A collaborative pro...
Innovative processing of cassava peels to livestock feeds—A collaborative pro...
 
ILRI overview
ILRI overviewILRI overview
ILRI overview
 
Livestock in the horn of Africa: An opportunity in waiting
Livestock in the horn of Africa: An opportunity in waiting Livestock in the horn of Africa: An opportunity in waiting
Livestock in the horn of Africa: An opportunity in waiting
 
African animal agriculture: Grasping opportunities
African animal agriculture: Grasping opportunitiesAfrican animal agriculture: Grasping opportunities
African animal agriculture: Grasping opportunities
 
Climate change and animal health
Climate change and animal healthClimate change and animal health
Climate change and animal health
 
Achieving Agenda 2030: Livestock research and the transformation of small-sca...
Achieving Agenda 2030: Livestock research and the transformation of small-sca...Achieving Agenda 2030: Livestock research and the transformation of small-sca...
Achieving Agenda 2030: Livestock research and the transformation of small-sca...
 
Studies of zoonoses in dynamic livestock systems in Kenya
Studies of zoonoses in dynamic livestock systems in KenyaStudies of zoonoses in dynamic livestock systems in Kenya
Studies of zoonoses in dynamic livestock systems in Kenya
 
Livestock: Opportunities for addressing global development challenges
Livestock: Opportunities for addressing global development challengesLivestock: Opportunities for addressing global development challenges
Livestock: Opportunities for addressing global development challenges
 
Manure management policies: A supportive tool for saving the earth and improv...
Manure management policies: A supportive tool for saving the earth and improv...Manure management policies: A supportive tool for saving the earth and improv...
Manure management policies: A supportive tool for saving the earth and improv...
 
The role of informal food markets—Towards professionalizing, not criminalizing
The role of informal food markets—Towards professionalizing, not criminalizingThe role of informal food markets—Towards professionalizing, not criminalizing
The role of informal food markets—Towards professionalizing, not criminalizing
 
Genomics selection in livestock: ILRI–ICARDA perspectives
Genomics selection in livestock: ILRI–ICARDA perspectivesGenomics selection in livestock: ILRI–ICARDA perspectives
Genomics selection in livestock: ILRI–ICARDA perspectives
 
Sustainable livestock insurance for pastoralists: From research to practice a...
Sustainable livestock insurance for pastoralists: From research to practice a...Sustainable livestock insurance for pastoralists: From research to practice a...
Sustainable livestock insurance for pastoralists: From research to practice a...
 
CGIAR Research Program on Agriculture for Improved Nutrition and Health
CGIAR Research Program on Agriculture for Improved Nutrition and HealthCGIAR Research Program on Agriculture for Improved Nutrition and Health
CGIAR Research Program on Agriculture for Improved Nutrition and Health
 
The emerging middle class and the world market for beef
The emerging middle class and  the world market for beefThe emerging middle class and  the world market for beef
The emerging middle class and the world market for beef
 

En vedette

Introducing some ILRI and CGIAR activities in Ethiopia
Introducing some ILRI and CGIAR activities in EthiopiaIntroducing some ILRI and CGIAR activities in Ethiopia
Introducing some ILRI and CGIAR activities in EthiopiaILRI
 
Overview of Capacity Development at ILRI
Overview of Capacity Development at ILRIOverview of Capacity Development at ILRI
Overview of Capacity Development at ILRIILRI
 
Food safety and informal markets: Animal products in sub-Saharan Africa
Food safety and informal markets: Animal products in sub-Saharan AfricaFood safety and informal markets: Animal products in sub-Saharan Africa
Food safety and informal markets: Animal products in sub-Saharan AfricaILRI
 
The road to CGSpace
The road to CGSpaceThe road to CGSpace
The road to CGSpaceILRI
 
Serological evidence of MERS-CoV antibodies in dromedary camels (Camelus drom...
Serological evidence of MERS-CoV antibodies in dromedary camels (Camelus drom...Serological evidence of MERS-CoV antibodies in dromedary camels (Camelus drom...
Serological evidence of MERS-CoV antibodies in dromedary camels (Camelus drom...ILRI
 
BecA-ILRI Hub capacity building program: Empowering African scientists and in...
BecA-ILRI Hub capacity building program: Empowering African scientists and in...BecA-ILRI Hub capacity building program: Empowering African scientists and in...
BecA-ILRI Hub capacity building program: Empowering African scientists and in...ILRI
 
Resilience and sustainable development: Insights from the drylands of eastern...
Resilience and sustainable development: Insights from the drylands of eastern...Resilience and sustainable development: Insights from the drylands of eastern...
Resilience and sustainable development: Insights from the drylands of eastern...ILRI
 
Why communicate animal genetics research
Why communicate  animal genetics research  Why communicate  animal genetics research
Why communicate animal genetics research ILRI
 
Livestock: The global context
Livestock: The global contextLivestock: The global context
Livestock: The global contextILRI
 
Setting international livestock research priorities: Some livestock research ...
Setting international livestock research priorities: Some livestock research ...Setting international livestock research priorities: Some livestock research ...
Setting international livestock research priorities: Some livestock research ...ILRI
 
Livestock, livelihoods and the future of India’s smallholder farmers
Livestock, livelihoods and the future of India’s smallholder farmersLivestock, livelihoods and the future of India’s smallholder farmers
Livestock, livelihoods and the future of India’s smallholder farmersILRI
 
Using social media to communicate research: Experiences of the International ...
Using social media to communicate research: Experiences of the International ...Using social media to communicate research: Experiences of the International ...
Using social media to communicate research: Experiences of the International ...ILRI
 
Antimicrobial resistance and the global livestock sector
Antimicrobial resistance and the global livestock sectorAntimicrobial resistance and the global livestock sector
Antimicrobial resistance and the global livestock sectorILRI
 
Climate smart livestock interventions
Climate smart livestock interventionsClimate smart livestock interventions
Climate smart livestock interventionsILRI
 

En vedette (15)

Introducing some ILRI and CGIAR activities in Ethiopia
Introducing some ILRI and CGIAR activities in EthiopiaIntroducing some ILRI and CGIAR activities in Ethiopia
Introducing some ILRI and CGIAR activities in Ethiopia
 
Overview of Capacity Development at ILRI
Overview of Capacity Development at ILRIOverview of Capacity Development at ILRI
Overview of Capacity Development at ILRI
 
Food safety and informal markets: Animal products in sub-Saharan Africa
Food safety and informal markets: Animal products in sub-Saharan AfricaFood safety and informal markets: Animal products in sub-Saharan Africa
Food safety and informal markets: Animal products in sub-Saharan Africa
 
The road to CGSpace
The road to CGSpaceThe road to CGSpace
The road to CGSpace
 
Serological evidence of MERS-CoV antibodies in dromedary camels (Camelus drom...
Serological evidence of MERS-CoV antibodies in dromedary camels (Camelus drom...Serological evidence of MERS-CoV antibodies in dromedary camels (Camelus drom...
Serological evidence of MERS-CoV antibodies in dromedary camels (Camelus drom...
 
BecA-ILRI Hub capacity building program: Empowering African scientists and in...
BecA-ILRI Hub capacity building program: Empowering African scientists and in...BecA-ILRI Hub capacity building program: Empowering African scientists and in...
BecA-ILRI Hub capacity building program: Empowering African scientists and in...
 
CCAFS 4 Degree World by Philip Thornton
CCAFS 4 Degree World by Philip Thornton CCAFS 4 Degree World by Philip Thornton
CCAFS 4 Degree World by Philip Thornton
 
Resilience and sustainable development: Insights from the drylands of eastern...
Resilience and sustainable development: Insights from the drylands of eastern...Resilience and sustainable development: Insights from the drylands of eastern...
Resilience and sustainable development: Insights from the drylands of eastern...
 
Why communicate animal genetics research
Why communicate  animal genetics research  Why communicate  animal genetics research
Why communicate animal genetics research
 
Livestock: The global context
Livestock: The global contextLivestock: The global context
Livestock: The global context
 
Setting international livestock research priorities: Some livestock research ...
Setting international livestock research priorities: Some livestock research ...Setting international livestock research priorities: Some livestock research ...
Setting international livestock research priorities: Some livestock research ...
 
Livestock, livelihoods and the future of India’s smallholder farmers
Livestock, livelihoods and the future of India’s smallholder farmersLivestock, livelihoods and the future of India’s smallholder farmers
Livestock, livelihoods and the future of India’s smallholder farmers
 
Using social media to communicate research: Experiences of the International ...
Using social media to communicate research: Experiences of the International ...Using social media to communicate research: Experiences of the International ...
Using social media to communicate research: Experiences of the International ...
 
Antimicrobial resistance and the global livestock sector
Antimicrobial resistance and the global livestock sectorAntimicrobial resistance and the global livestock sector
Antimicrobial resistance and the global livestock sector
 
Climate smart livestock interventions
Climate smart livestock interventionsClimate smart livestock interventions
Climate smart livestock interventions
 

Similaire à Towards successful, and sustainable, livestock futures worldwide

Livestock in developing countries: Animal health challenges and opportunities
Livestock in developing countries: Animal health challenges and opportunities Livestock in developing countries: Animal health challenges and opportunities
Livestock in developing countries: Animal health challenges and opportunities ILRI
 
Better lives through livestock: ILRI overview
Better lives through livestock: ILRI overviewBetter lives through livestock: ILRI overview
Better lives through livestock: ILRI overviewILRI
 
Livestock headwinds:Help or hindrance to sustainable development?
Livestock headwinds:Help or hindrance to sustainable development?Livestock headwinds:Help or hindrance to sustainable development?
Livestock headwinds:Help or hindrance to sustainable development?ILRI
 
Sustainable and productive farming systems: The livestock sector
Sustainable and productive farming systems: The livestock sectorSustainable and productive farming systems: The livestock sector
Sustainable and productive farming systems: The livestock sectorACIAR
 
The future of sustainable livestock systems in low- and middle-income countries
The future of sustainable livestock systems in low- and middle-income countriesThe future of sustainable livestock systems in low- and middle-income countries
The future of sustainable livestock systems in low- and middle-income countriesILRI
 
Closing livestock yield gaps in the developing world: Imperatives for people ...
Closing livestock yield gaps in the developing world: Imperatives for people ...Closing livestock yield gaps in the developing world: Imperatives for people ...
Closing livestock yield gaps in the developing world: Imperatives for people ...ILRI
 
Animal research: Addressing the needs of the coming 50 years
Animal research: Addressing the needs of the coming 50 yearsAnimal research: Addressing the needs of the coming 50 years
Animal research: Addressing the needs of the coming 50 yearsILRI
 
Transforming the global food systems: Challenges and opportunities
Transforming the global food systems: Challenges and opportunitiesTransforming the global food systems: Challenges and opportunities
Transforming the global food systems: Challenges and opportunitiesILRI
 
Mixed crop-livestock systems: Indispensable means to achieving global food an...
Mixed crop-livestock systems: Indispensable means to achieving global food an...Mixed crop-livestock systems: Indispensable means to achieving global food an...
Mixed crop-livestock systems: Indispensable means to achieving global food an...ILRI
 
Better lives through livestock: ILRI in SADC Region
Better lives through livestock: ILRI in SADC Region Better lives through livestock: ILRI in SADC Region
Better lives through livestock: ILRI in SADC Region ILRI
 
Evolution of animal production in emerging markets: China, Russia, India, Bra...
Evolution of animal production in emerging markets: China, Russia, India, Bra...Evolution of animal production in emerging markets: China, Russia, India, Bra...
Evolution of animal production in emerging markets: China, Russia, India, Bra...ILRI
 
Ensuring livestock livelihoods and animal source food security
Ensuring livestock livelihoods and animal source food securityEnsuring livestock livelihoods and animal source food security
Ensuring livestock livelihoods and animal source food securityILRI
 
People, their livestock, livelihood and diseases: complexity of interrelation...
People, their livestock, livelihood and diseases: complexity of interrelation...People, their livestock, livelihood and diseases: complexity of interrelation...
People, their livestock, livelihood and diseases: complexity of interrelation...African Dairy Conference and Exhibition
 
Animal breeding for reduced poverty and improved food security in developing ...
Animal breeding for reduced poverty and improved food security in developing ...Animal breeding for reduced poverty and improved food security in developing ...
Animal breeding for reduced poverty and improved food security in developing ...ILRI
 
The developing world’s smallholder livestock sector
The developing world’s smallholder livestock sector   The developing world’s smallholder livestock sector
The developing world’s smallholder livestock sector ILRI
 
Healthy animals for healthy food
Healthy animals for healthy foodHealthy animals for healthy food
Healthy animals for healthy foodILRI
 
One Health approaches to different problems: Work at the International Livest...
One Health approaches to different problems: Work at the International Livest...One Health approaches to different problems: Work at the International Livest...
One Health approaches to different problems: Work at the International Livest...ILRI
 
Livestock research for Africa’s food security and poverty reduction
Livestock research for Africa’s food security and poverty reductionLivestock research for Africa’s food security and poverty reduction
Livestock research for Africa’s food security and poverty reductionILRI
 
Global health and sustainable food security: Why the livestock sectors of dev...
Global health and sustainable food security: Why the livestock sectors of dev...Global health and sustainable food security: Why the livestock sectors of dev...
Global health and sustainable food security: Why the livestock sectors of dev...ILRI
 

Similaire à Towards successful, and sustainable, livestock futures worldwide (20)

Livestock in developing countries: Animal health challenges and opportunities
Livestock in developing countries: Animal health challenges and opportunities Livestock in developing countries: Animal health challenges and opportunities
Livestock in developing countries: Animal health challenges and opportunities
 
Better lives through livestock: ILRI overview
Better lives through livestock: ILRI overviewBetter lives through livestock: ILRI overview
Better lives through livestock: ILRI overview
 
Livestock headwinds:Help or hindrance to sustainable development?
Livestock headwinds:Help or hindrance to sustainable development?Livestock headwinds:Help or hindrance to sustainable development?
Livestock headwinds:Help or hindrance to sustainable development?
 
Sustainable and productive farming systems: The livestock sector
Sustainable and productive farming systems: The livestock sectorSustainable and productive farming systems: The livestock sector
Sustainable and productive farming systems: The livestock sector
 
The future of sustainable livestock systems in low- and middle-income countries
The future of sustainable livestock systems in low- and middle-income countriesThe future of sustainable livestock systems in low- and middle-income countries
The future of sustainable livestock systems in low- and middle-income countries
 
Closing livestock yield gaps in the developing world: Imperatives for people ...
Closing livestock yield gaps in the developing world: Imperatives for people ...Closing livestock yield gaps in the developing world: Imperatives for people ...
Closing livestock yield gaps in the developing world: Imperatives for people ...
 
Animal research: Addressing the needs of the coming 50 years
Animal research: Addressing the needs of the coming 50 yearsAnimal research: Addressing the needs of the coming 50 years
Animal research: Addressing the needs of the coming 50 years
 
Transforming the global food systems: Challenges and opportunities
Transforming the global food systems: Challenges and opportunitiesTransforming the global food systems: Challenges and opportunities
Transforming the global food systems: Challenges and opportunities
 
Mixed crop-livestock systems: Indispensable means to achieving global food an...
Mixed crop-livestock systems: Indispensable means to achieving global food an...Mixed crop-livestock systems: Indispensable means to achieving global food an...
Mixed crop-livestock systems: Indispensable means to achieving global food an...
 
People, their livestock, livelihood and diseases. compllexity of interrelatio...
People, their livestock, livelihood and diseases. compllexity of interrelatio...People, their livestock, livelihood and diseases. compllexity of interrelatio...
People, their livestock, livelihood and diseases. compllexity of interrelatio...
 
Better lives through livestock: ILRI in SADC Region
Better lives through livestock: ILRI in SADC Region Better lives through livestock: ILRI in SADC Region
Better lives through livestock: ILRI in SADC Region
 
Evolution of animal production in emerging markets: China, Russia, India, Bra...
Evolution of animal production in emerging markets: China, Russia, India, Bra...Evolution of animal production in emerging markets: China, Russia, India, Bra...
Evolution of animal production in emerging markets: China, Russia, India, Bra...
 
Ensuring livestock livelihoods and animal source food security
Ensuring livestock livelihoods and animal source food securityEnsuring livestock livelihoods and animal source food security
Ensuring livestock livelihoods and animal source food security
 
People, their livestock, livelihood and diseases: complexity of interrelation...
People, their livestock, livelihood and diseases: complexity of interrelation...People, their livestock, livelihood and diseases: complexity of interrelation...
People, their livestock, livelihood and diseases: complexity of interrelation...
 
Animal breeding for reduced poverty and improved food security in developing ...
Animal breeding for reduced poverty and improved food security in developing ...Animal breeding for reduced poverty and improved food security in developing ...
Animal breeding for reduced poverty and improved food security in developing ...
 
The developing world’s smallholder livestock sector
The developing world’s smallholder livestock sector   The developing world’s smallholder livestock sector
The developing world’s smallholder livestock sector
 
Healthy animals for healthy food
Healthy animals for healthy foodHealthy animals for healthy food
Healthy animals for healthy food
 
One Health approaches to different problems: Work at the International Livest...
One Health approaches to different problems: Work at the International Livest...One Health approaches to different problems: Work at the International Livest...
One Health approaches to different problems: Work at the International Livest...
 
Livestock research for Africa’s food security and poverty reduction
Livestock research for Africa’s food security and poverty reductionLivestock research for Africa’s food security and poverty reduction
Livestock research for Africa’s food security and poverty reduction
 
Global health and sustainable food security: Why the livestock sectors of dev...
Global health and sustainable food security: Why the livestock sectors of dev...Global health and sustainable food security: Why the livestock sectors of dev...
Global health and sustainable food security: Why the livestock sectors of dev...
 

Plus de ILRI

How the small-scale low biosecurity sector could be transformed into a more b...
How the small-scale low biosecurity sector could be transformed into a more b...How the small-scale low biosecurity sector could be transformed into a more b...
How the small-scale low biosecurity sector could be transformed into a more b...ILRI
 
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...ILRI
 
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...ILRI
 
A training, certification and marketing scheme for informal dairy vendors in ...
A training, certification and marketing scheme for informal dairy vendors in ...A training, certification and marketing scheme for informal dairy vendors in ...
A training, certification and marketing scheme for informal dairy vendors in ...ILRI
 
Milk safety and child nutrition impacts of the MoreMilk training, certificati...
Milk safety and child nutrition impacts of the MoreMilk training, certificati...Milk safety and child nutrition impacts of the MoreMilk training, certificati...
Milk safety and child nutrition impacts of the MoreMilk training, certificati...ILRI
 
Preventing the next pandemic: a 12-slide primer on emerging zoonotic diseases
Preventing the next pandemic: a 12-slide primer on emerging zoonotic diseasesPreventing the next pandemic: a 12-slide primer on emerging zoonotic diseases
Preventing the next pandemic: a 12-slide primer on emerging zoonotic diseasesILRI
 
Preventing preventable diseases: a 12-slide primer on foodborne disease
Preventing preventable diseases: a 12-slide primer on foodborne diseasePreventing preventable diseases: a 12-slide primer on foodborne disease
Preventing preventable diseases: a 12-slide primer on foodborne diseaseILRI
 
Preventing a post-antibiotic era: a 12-slide primer on antimicrobial resistance
Preventing a post-antibiotic era: a 12-slide primer on antimicrobial resistancePreventing a post-antibiotic era: a 12-slide primer on antimicrobial resistance
Preventing a post-antibiotic era: a 12-slide primer on antimicrobial resistanceILRI
 
Food safety research in low- and middle-income countries
Food safety research in low- and middle-income countriesFood safety research in low- and middle-income countries
Food safety research in low- and middle-income countriesILRI
 
Food safety research LMIC
Food safety research LMICFood safety research LMIC
Food safety research LMICILRI
 
The application of One Health: Observations from eastern and southern Africa
The application of One Health: Observations from eastern and southern AfricaThe application of One Health: Observations from eastern and southern Africa
The application of One Health: Observations from eastern and southern AfricaILRI
 
One Health in action: Perspectives from 10 years in the field
One Health in action: Perspectives from 10 years in the fieldOne Health in action: Perspectives from 10 years in the field
One Health in action: Perspectives from 10 years in the fieldILRI
 
Reservoirs of pathogenic Leptospira species in Uganda
Reservoirs of pathogenic Leptospira species in UgandaReservoirs of pathogenic Leptospira species in Uganda
Reservoirs of pathogenic Leptospira species in UgandaILRI
 
Minyoo ya mbwa
Minyoo ya mbwaMinyoo ya mbwa
Minyoo ya mbwaILRI
 
Parasites in dogs
Parasites in dogsParasites in dogs
Parasites in dogsILRI
 
Assessing meat microbiological safety and associated handling practices in bu...
Assessing meat microbiological safety and associated handling practices in bu...Assessing meat microbiological safety and associated handling practices in bu...
Assessing meat microbiological safety and associated handling practices in bu...ILRI
 
Ecological factors associated with abundance and distribution of mosquito vec...
Ecological factors associated with abundance and distribution of mosquito vec...Ecological factors associated with abundance and distribution of mosquito vec...
Ecological factors associated with abundance and distribution of mosquito vec...ILRI
 
Livestock in the agrifood systems transformation
Livestock in the agrifood systems transformationLivestock in the agrifood systems transformation
Livestock in the agrifood systems transformationILRI
 
Development of a fluorescent RBL reporter system for diagnosis of porcine cys...
Development of a fluorescent RBL reporter system for diagnosis of porcine cys...Development of a fluorescent RBL reporter system for diagnosis of porcine cys...
Development of a fluorescent RBL reporter system for diagnosis of porcine cys...ILRI
 
Practices and drivers of antibiotic use in Kenyan smallholder dairy farms
Practices and drivers of antibiotic use in Kenyan smallholder dairy farmsPractices and drivers of antibiotic use in Kenyan smallholder dairy farms
Practices and drivers of antibiotic use in Kenyan smallholder dairy farmsILRI
 

Plus de ILRI (20)

How the small-scale low biosecurity sector could be transformed into a more b...
How the small-scale low biosecurity sector could be transformed into a more b...How the small-scale low biosecurity sector could be transformed into a more b...
How the small-scale low biosecurity sector could be transformed into a more b...
 
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...
 
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...
 
A training, certification and marketing scheme for informal dairy vendors in ...
A training, certification and marketing scheme for informal dairy vendors in ...A training, certification and marketing scheme for informal dairy vendors in ...
A training, certification and marketing scheme for informal dairy vendors in ...
 
Milk safety and child nutrition impacts of the MoreMilk training, certificati...
Milk safety and child nutrition impacts of the MoreMilk training, certificati...Milk safety and child nutrition impacts of the MoreMilk training, certificati...
Milk safety and child nutrition impacts of the MoreMilk training, certificati...
 
Preventing the next pandemic: a 12-slide primer on emerging zoonotic diseases
Preventing the next pandemic: a 12-slide primer on emerging zoonotic diseasesPreventing the next pandemic: a 12-slide primer on emerging zoonotic diseases
Preventing the next pandemic: a 12-slide primer on emerging zoonotic diseases
 
Preventing preventable diseases: a 12-slide primer on foodborne disease
Preventing preventable diseases: a 12-slide primer on foodborne diseasePreventing preventable diseases: a 12-slide primer on foodborne disease
Preventing preventable diseases: a 12-slide primer on foodborne disease
 
Preventing a post-antibiotic era: a 12-slide primer on antimicrobial resistance
Preventing a post-antibiotic era: a 12-slide primer on antimicrobial resistancePreventing a post-antibiotic era: a 12-slide primer on antimicrobial resistance
Preventing a post-antibiotic era: a 12-slide primer on antimicrobial resistance
 
Food safety research in low- and middle-income countries
Food safety research in low- and middle-income countriesFood safety research in low- and middle-income countries
Food safety research in low- and middle-income countries
 
Food safety research LMIC
Food safety research LMICFood safety research LMIC
Food safety research LMIC
 
The application of One Health: Observations from eastern and southern Africa
The application of One Health: Observations from eastern and southern AfricaThe application of One Health: Observations from eastern and southern Africa
The application of One Health: Observations from eastern and southern Africa
 
One Health in action: Perspectives from 10 years in the field
One Health in action: Perspectives from 10 years in the fieldOne Health in action: Perspectives from 10 years in the field
One Health in action: Perspectives from 10 years in the field
 
Reservoirs of pathogenic Leptospira species in Uganda
Reservoirs of pathogenic Leptospira species in UgandaReservoirs of pathogenic Leptospira species in Uganda
Reservoirs of pathogenic Leptospira species in Uganda
 
Minyoo ya mbwa
Minyoo ya mbwaMinyoo ya mbwa
Minyoo ya mbwa
 
Parasites in dogs
Parasites in dogsParasites in dogs
Parasites in dogs
 
Assessing meat microbiological safety and associated handling practices in bu...
Assessing meat microbiological safety and associated handling practices in bu...Assessing meat microbiological safety and associated handling practices in bu...
Assessing meat microbiological safety and associated handling practices in bu...
 
Ecological factors associated with abundance and distribution of mosquito vec...
Ecological factors associated with abundance and distribution of mosquito vec...Ecological factors associated with abundance and distribution of mosquito vec...
Ecological factors associated with abundance and distribution of mosquito vec...
 
Livestock in the agrifood systems transformation
Livestock in the agrifood systems transformationLivestock in the agrifood systems transformation
Livestock in the agrifood systems transformation
 
Development of a fluorescent RBL reporter system for diagnosis of porcine cys...
Development of a fluorescent RBL reporter system for diagnosis of porcine cys...Development of a fluorescent RBL reporter system for diagnosis of porcine cys...
Development of a fluorescent RBL reporter system for diagnosis of porcine cys...
 
Practices and drivers of antibiotic use in Kenyan smallholder dairy farms
Practices and drivers of antibiotic use in Kenyan smallholder dairy farmsPractices and drivers of antibiotic use in Kenyan smallholder dairy farms
Practices and drivers of antibiotic use in Kenyan smallholder dairy farms
 

Dernier

Speech, hearing, noise, intelligibility.pptx
Speech, hearing, noise, intelligibility.pptxSpeech, hearing, noise, intelligibility.pptx
Speech, hearing, noise, intelligibility.pptxpriyankatabhane
 
BIOETHICS IN RECOMBINANT DNA TECHNOLOGY.
BIOETHICS IN RECOMBINANT DNA TECHNOLOGY.BIOETHICS IN RECOMBINANT DNA TECHNOLOGY.
BIOETHICS IN RECOMBINANT DNA TECHNOLOGY.PraveenaKalaiselvan1
 
Pests of Blackgram, greengram, cowpea_Dr.UPR.pdf
Pests of Blackgram, greengram, cowpea_Dr.UPR.pdfPests of Blackgram, greengram, cowpea_Dr.UPR.pdf
Pests of Blackgram, greengram, cowpea_Dr.UPR.pdfPirithiRaju
 
Microphone- characteristics,carbon microphone, dynamic microphone.pptx
Microphone- characteristics,carbon microphone, dynamic microphone.pptxMicrophone- characteristics,carbon microphone, dynamic microphone.pptx
Microphone- characteristics,carbon microphone, dynamic microphone.pptxpriyankatabhane
 
Topic 9- General Principles of International Law.pptx
Topic 9- General Principles of International Law.pptxTopic 9- General Principles of International Law.pptx
Topic 9- General Principles of International Law.pptxJorenAcuavera1
 
REVISTA DE BIOLOGIA E CIÊNCIAS DA TERRA ISSN 1519-5228 - Artigo_Bioterra_V24_...
REVISTA DE BIOLOGIA E CIÊNCIAS DA TERRA ISSN 1519-5228 - Artigo_Bioterra_V24_...REVISTA DE BIOLOGIA E CIÊNCIAS DA TERRA ISSN 1519-5228 - Artigo_Bioterra_V24_...
REVISTA DE BIOLOGIA E CIÊNCIAS DA TERRA ISSN 1519-5228 - Artigo_Bioterra_V24_...Universidade Federal de Sergipe - UFS
 
Dubai Calls Girl Lisa O525547819 Lexi Call Girls In Dubai
Dubai Calls Girl Lisa O525547819 Lexi Call Girls In DubaiDubai Calls Girl Lisa O525547819 Lexi Call Girls In Dubai
Dubai Calls Girl Lisa O525547819 Lexi Call Girls In Dubaikojalkojal131
 
Pests of soyabean_Binomics_IdentificationDr.UPR.pdf
Pests of soyabean_Binomics_IdentificationDr.UPR.pdfPests of soyabean_Binomics_IdentificationDr.UPR.pdf
Pests of soyabean_Binomics_IdentificationDr.UPR.pdfPirithiRaju
 
THE ROLE OF PHARMACOGNOSY IN TRADITIONAL AND MODERN SYSTEM OF MEDICINE.pptx
THE ROLE OF PHARMACOGNOSY IN TRADITIONAL AND MODERN SYSTEM OF MEDICINE.pptxTHE ROLE OF PHARMACOGNOSY IN TRADITIONAL AND MODERN SYSTEM OF MEDICINE.pptx
THE ROLE OF PHARMACOGNOSY IN TRADITIONAL AND MODERN SYSTEM OF MEDICINE.pptxNandakishor Bhaurao Deshmukh
 
Davis plaque method.pptx recombinant DNA technology
Davis plaque method.pptx recombinant DNA technologyDavis plaque method.pptx recombinant DNA technology
Davis plaque method.pptx recombinant DNA technologycaarthichand2003
 
Neurodevelopmental disorders according to the dsm 5 tr
Neurodevelopmental disorders according to the dsm 5 trNeurodevelopmental disorders according to the dsm 5 tr
Neurodevelopmental disorders according to the dsm 5 trssuser06f238
 
(9818099198) Call Girls In Noida Sector 14 (NOIDA ESCORTS)
(9818099198) Call Girls In Noida Sector 14 (NOIDA ESCORTS)(9818099198) Call Girls In Noida Sector 14 (NOIDA ESCORTS)
(9818099198) Call Girls In Noida Sector 14 (NOIDA ESCORTS)riyaescorts54
 
Four Spheres of the Earth Presentation.ppt
Four Spheres of the Earth Presentation.pptFour Spheres of the Earth Presentation.ppt
Four Spheres of the Earth Presentation.pptJoemSTuliba
 
User Guide: Capricorn FLX™ Weather Station
User Guide: Capricorn FLX™ Weather StationUser Guide: Capricorn FLX™ Weather Station
User Guide: Capricorn FLX™ Weather StationColumbia Weather Systems
 
Call Girls in Majnu Ka Tilla Delhi 🔝9711014705🔝 Genuine
Call Girls in Majnu Ka Tilla Delhi 🔝9711014705🔝 GenuineCall Girls in Majnu Ka Tilla Delhi 🔝9711014705🔝 Genuine
Call Girls in Majnu Ka Tilla Delhi 🔝9711014705🔝 Genuinethapagita
 
FREE NURSING BUNDLE FOR NURSES.PDF by na
FREE NURSING BUNDLE FOR NURSES.PDF by naFREE NURSING BUNDLE FOR NURSES.PDF by na
FREE NURSING BUNDLE FOR NURSES.PDF by naJASISJULIANOELYNV
 
Pests of jatropha_Bionomics_identification_Dr.UPR.pdf
Pests of jatropha_Bionomics_identification_Dr.UPR.pdfPests of jatropha_Bionomics_identification_Dr.UPR.pdf
Pests of jatropha_Bionomics_identification_Dr.UPR.pdfPirithiRaju
 
Fertilization: Sperm and the egg—collectively called the gametes—fuse togethe...
Fertilization: Sperm and the egg—collectively called the gametes—fuse togethe...Fertilization: Sperm and the egg—collectively called the gametes—fuse togethe...
Fertilization: Sperm and the egg—collectively called the gametes—fuse togethe...D. B. S. College Kanpur
 
Call Girls In Nihal Vihar Delhi ❤️8860477959 Looking Escorts In 24/7 Delhi NCR
Call Girls In Nihal Vihar Delhi ❤️8860477959 Looking Escorts In 24/7 Delhi NCRCall Girls In Nihal Vihar Delhi ❤️8860477959 Looking Escorts In 24/7 Delhi NCR
Call Girls In Nihal Vihar Delhi ❤️8860477959 Looking Escorts In 24/7 Delhi NCRlizamodels9
 
Best Call Girls In Sector 29 Gurgaon❤️8860477959 EscorTs Service In 24/7 Delh...
Best Call Girls In Sector 29 Gurgaon❤️8860477959 EscorTs Service In 24/7 Delh...Best Call Girls In Sector 29 Gurgaon❤️8860477959 EscorTs Service In 24/7 Delh...
Best Call Girls In Sector 29 Gurgaon❤️8860477959 EscorTs Service In 24/7 Delh...lizamodels9
 

Dernier (20)

Speech, hearing, noise, intelligibility.pptx
Speech, hearing, noise, intelligibility.pptxSpeech, hearing, noise, intelligibility.pptx
Speech, hearing, noise, intelligibility.pptx
 
BIOETHICS IN RECOMBINANT DNA TECHNOLOGY.
BIOETHICS IN RECOMBINANT DNA TECHNOLOGY.BIOETHICS IN RECOMBINANT DNA TECHNOLOGY.
BIOETHICS IN RECOMBINANT DNA TECHNOLOGY.
 
Pests of Blackgram, greengram, cowpea_Dr.UPR.pdf
Pests of Blackgram, greengram, cowpea_Dr.UPR.pdfPests of Blackgram, greengram, cowpea_Dr.UPR.pdf
Pests of Blackgram, greengram, cowpea_Dr.UPR.pdf
 
Microphone- characteristics,carbon microphone, dynamic microphone.pptx
Microphone- characteristics,carbon microphone, dynamic microphone.pptxMicrophone- characteristics,carbon microphone, dynamic microphone.pptx
Microphone- characteristics,carbon microphone, dynamic microphone.pptx
 
Topic 9- General Principles of International Law.pptx
Topic 9- General Principles of International Law.pptxTopic 9- General Principles of International Law.pptx
Topic 9- General Principles of International Law.pptx
 
REVISTA DE BIOLOGIA E CIÊNCIAS DA TERRA ISSN 1519-5228 - Artigo_Bioterra_V24_...
REVISTA DE BIOLOGIA E CIÊNCIAS DA TERRA ISSN 1519-5228 - Artigo_Bioterra_V24_...REVISTA DE BIOLOGIA E CIÊNCIAS DA TERRA ISSN 1519-5228 - Artigo_Bioterra_V24_...
REVISTA DE BIOLOGIA E CIÊNCIAS DA TERRA ISSN 1519-5228 - Artigo_Bioterra_V24_...
 
Dubai Calls Girl Lisa O525547819 Lexi Call Girls In Dubai
Dubai Calls Girl Lisa O525547819 Lexi Call Girls In DubaiDubai Calls Girl Lisa O525547819 Lexi Call Girls In Dubai
Dubai Calls Girl Lisa O525547819 Lexi Call Girls In Dubai
 
Pests of soyabean_Binomics_IdentificationDr.UPR.pdf
Pests of soyabean_Binomics_IdentificationDr.UPR.pdfPests of soyabean_Binomics_IdentificationDr.UPR.pdf
Pests of soyabean_Binomics_IdentificationDr.UPR.pdf
 
THE ROLE OF PHARMACOGNOSY IN TRADITIONAL AND MODERN SYSTEM OF MEDICINE.pptx
THE ROLE OF PHARMACOGNOSY IN TRADITIONAL AND MODERN SYSTEM OF MEDICINE.pptxTHE ROLE OF PHARMACOGNOSY IN TRADITIONAL AND MODERN SYSTEM OF MEDICINE.pptx
THE ROLE OF PHARMACOGNOSY IN TRADITIONAL AND MODERN SYSTEM OF MEDICINE.pptx
 
Davis plaque method.pptx recombinant DNA technology
Davis plaque method.pptx recombinant DNA technologyDavis plaque method.pptx recombinant DNA technology
Davis plaque method.pptx recombinant DNA technology
 
Neurodevelopmental disorders according to the dsm 5 tr
Neurodevelopmental disorders according to the dsm 5 trNeurodevelopmental disorders according to the dsm 5 tr
Neurodevelopmental disorders according to the dsm 5 tr
 
(9818099198) Call Girls In Noida Sector 14 (NOIDA ESCORTS)
(9818099198) Call Girls In Noida Sector 14 (NOIDA ESCORTS)(9818099198) Call Girls In Noida Sector 14 (NOIDA ESCORTS)
(9818099198) Call Girls In Noida Sector 14 (NOIDA ESCORTS)
 
Four Spheres of the Earth Presentation.ppt
Four Spheres of the Earth Presentation.pptFour Spheres of the Earth Presentation.ppt
Four Spheres of the Earth Presentation.ppt
 
User Guide: Capricorn FLX™ Weather Station
User Guide: Capricorn FLX™ Weather StationUser Guide: Capricorn FLX™ Weather Station
User Guide: Capricorn FLX™ Weather Station
 
Call Girls in Majnu Ka Tilla Delhi 🔝9711014705🔝 Genuine
Call Girls in Majnu Ka Tilla Delhi 🔝9711014705🔝 GenuineCall Girls in Majnu Ka Tilla Delhi 🔝9711014705🔝 Genuine
Call Girls in Majnu Ka Tilla Delhi 🔝9711014705🔝 Genuine
 
FREE NURSING BUNDLE FOR NURSES.PDF by na
FREE NURSING BUNDLE FOR NURSES.PDF by naFREE NURSING BUNDLE FOR NURSES.PDF by na
FREE NURSING BUNDLE FOR NURSES.PDF by na
 
Pests of jatropha_Bionomics_identification_Dr.UPR.pdf
Pests of jatropha_Bionomics_identification_Dr.UPR.pdfPests of jatropha_Bionomics_identification_Dr.UPR.pdf
Pests of jatropha_Bionomics_identification_Dr.UPR.pdf
 
Fertilization: Sperm and the egg—collectively called the gametes—fuse togethe...
Fertilization: Sperm and the egg—collectively called the gametes—fuse togethe...Fertilization: Sperm and the egg—collectively called the gametes—fuse togethe...
Fertilization: Sperm and the egg—collectively called the gametes—fuse togethe...
 
Call Girls In Nihal Vihar Delhi ❤️8860477959 Looking Escorts In 24/7 Delhi NCR
Call Girls In Nihal Vihar Delhi ❤️8860477959 Looking Escorts In 24/7 Delhi NCRCall Girls In Nihal Vihar Delhi ❤️8860477959 Looking Escorts In 24/7 Delhi NCR
Call Girls In Nihal Vihar Delhi ❤️8860477959 Looking Escorts In 24/7 Delhi NCR
 
Best Call Girls In Sector 29 Gurgaon❤️8860477959 EscorTs Service In 24/7 Delh...
Best Call Girls In Sector 29 Gurgaon❤️8860477959 EscorTs Service In 24/7 Delh...Best Call Girls In Sector 29 Gurgaon❤️8860477959 EscorTs Service In 24/7 Delh...
Best Call Girls In Sector 29 Gurgaon❤️8860477959 EscorTs Service In 24/7 Delh...
 

Towards successful, and sustainable, livestock futures worldwide

  • 1. Towards successful, and sustainable, livestock futures worldwide Borlaug distinguished lecture Texas A&M University, 3 March 2015 Jimmy Smith  Director General  ILRI
  • 2. The global livestock sector: Changes ahead 40% of agricultural GDP and growing
  • 3. 4of5highest valueglobal commodities arelivestock FAOSTAT 2014 (values for 2012) 0 200 400 600 800 1000 1200 1400 1600 1800 2000 0 20 40 60 80 100 120 140 160 180 200 Production(MT)millions Netproductionvalue(Int$)billion net production value (Int $) billion production (MT) Cow milk has overtaken rice Eggs have displaced maize
  • 4. Per capita global kilocalorie availability from edible animal products Source: Herrero et al (PNAS, in press)
  • 5. Gains in meat consumption in developing countries are outpacing those of developed 0 100 200 300 400 500 600 700 800 1980 1990 2002 2015 2030 2050 Millionmetrictonnes developing countries developed countries Hypothetical: If developing-country per capita consumption rate equalled that of developed countries
  • 6. Milk demand and consumption levels differ in developed and developing countries 0 100 200 300 400 500 600 700 800 900 1000 2005/07 2050 Demand for milk million t/annum Developing Developed 0 50 100 150 200 250 2005/07 2050 Milk consumption kg/capita/annum Developed Developing
  • 7. Rising demand for meat, milk and eggs is a global phenomenon . . . . . . but demand is greatest in South Asia and Sub-Saharan Africa
  • 8. FAO 2012Based on anticipated change in absolute tonnes of product comparing 2000 and 2030 Percentage growth in demand for livestock products: 2000−2030
  • 9. Huge increases over 2005/7 amounts of cereals, dairy and meat will be needed by 2050 From 2bn−3bn tonnes cereals each year From 664m−1bn tonnes dairy each year From 258m−460m tonnes meat each year
  • 10. The global livestock sector: Opportunities and challenges
  • 11. Opportunities: Why The demographics of demand and supply open new, unprecedented, opportunities: • To enable smallholders to continue to play central roles in food and nutritional security • To transform livelihoods and rural economies in developing countries • To make animal agriculture more environmentally sustainable
  • 12. Opportunities: Who • 90% of animal products are produced & consumed in same country or region • Most are produced by smallholders • More than 70% of livestock products are sold informally • 500m smallholders produce 80% of developing-world food • 43% of the agricultural workforce is female
  • 13. BMGF, FAO, ILRI Smallholders still dominate livestock production in many countries Region (definition of ‘smallholder’) % production by smallholder livestock farms Beef Chicken meat Sheep/goat meat Milk Pork Eggs East Africa (≤ 6 milking animals) 60-90 Bangladesh (< 3ha land) 65 77 78 65 77 India (< 2ha land) 75 92 92 69 71 Vietnam (small scale) 80 Philippines (backyard) 50 35
  • 14. Opportunities: How This rising demand for animal-source foods will be met − one way or another We can meet that demand in economically viable, sustainable, equitable and healthy ways that also reduce poverty and hunger This requires proactive action
  • 15. Demand for livestock commodities in developing economies will be met – the only question is how Scenario #1 Meeting livestock demand by importing livestock products Scenario #2 Meeting livestock demand by importing livestock industrial production know-how Scenario #3 Meeting livestock demand by transforming smallholder livestock systems
  • 16. Scenario #3 is good news for rural economic transformation Upsides of smallholder transformation • The coming livestock transitions and consolidations can help millions improve their food production as well as health, livelihoods and environments • Of the world’s 1 billion smallholder livestock producers, some: ﹣1/3 will find alternate livelihoods ﹣1/3 will succeed in the market ﹣1/3 could go either way
  • 18. Trajectories of growth • ‘Strong growth’ – Intensifying and increasingly market oriented often transforming smallholder systems • ‘Fragile growth’ – Where remoteness, marginal land resources or agro climatic vulnerability restrict intensification • ‘High growth with externalities’ (industrial) – Intensified livestock systems with diverse challenges including the environment and human health
  • 19. Trajectory ‘Strong growth’ Sector Ruminant meat and milk, esp. in SSA, India − Pork in some regions Issues − Sustainable productivity - Market access and food safety − Zoonotic outbreaks Opportunities Novel approaches spanning sustainable productivity, markets, institutional and policy issues, risk analyses ‘Fragile growth’ Some smallholder and pastoral systems; little part in the production response − Multiple endemic diseases − Zoonoses − Adaptive capacity − Movement controls Mostly public sector interventions, mitigating vulnerability, improving resilience ‘High growth with externalities’ Mostly monogastric − China for all commodities − Environmental - Drug resistance − Climate impacts on new vector and pathogen dynamics − Disease scares Modalities of operation with private sector largely established. Managing environment and health risks and consumer demand Distinguishing opportunities
  • 20. Research for development solutions Food, equity, environment, health Policies, institutions and markets - Policy development - Foresight; trade - Livestock value chains Sustainable livestock systems - Sustainable intensification - Climate change: adaptation & mitigation - System resilience Feed resources - Conservation & use - Feed production - Feed utilization Animal genetics and breeding - Gene discovery - Genetic improvement - Breeding strategies - conservation Livestock – health - Vaccines & diagnostics - Zoonoses; food safety - Herd health
  • 21. Greatest burden of zoonoses falls on one billion poor livestock keepers Map by ILRI, from original in a report to DFID: Mapping of Poverty and Likely Zoonoses Hotspots, 2012
  • 22. 199 8 2007 African swine fever: Threatens $150-billion global pig industry Recent reports indicate ASF has moved into Belarus, Poland and Lithuania
  • 23. Vaccines save lives of animals that both increase food security and reduce poverty ILVAC – a global vaccine initiative An body technologies Vaccine technologies Cellular technologies Diagnos c technologies Genomic technologies Contagiousbovine pleuropneumonia EastCoastfever Africanswinefever Consor a for research & product development and capacity development Private sector GALVmed CRPs NARS Inter-gov agencies Improved vaccines and diagnos c tools Pestedespesruminants RiValleyfever Infec ous disease research: basic & applied ILVAC – a vaccine pla orm
  • 24. ECF Consortium: Improved vaccines to control lethal East Coast fever infections in cattle in Africa Annual meeting, Addis Ababa, 9-11th February 2015
  • 25. African swine fever: TAMU-ILRI planned research for generating a subunit vaccine (funding still required) • TAMU developed two candidate multivalent vaccines • The vaccines are well tolerated by piglets & stimulate robust antibody & T-cell responses in the animals • Below left: The antibodies induced were shown to recognize the ASF virus Studies to determine protective value of the vaccines is pending (Funding) • Above right: Challenge with virulent Kenyan ASF virus to test vaccine efficacy will be performed in ILRI BSL2 pig unit using virulent Kenyan ASF virus isolated & characterized by ILRI
  • 26. Food safety • 90% of animal products are produced and consumed in the same region • Over 70% of livestock products are sold ‘informally’ • There are major opportunities to ensure that milk, meat and eggs are safe for consumption (e.g. via risk assessments and risk- rather than rule-based regulations) • ‘Intensifying’ livestock production systems bring people and animals closer together, increasing the threat of zoonotic disease outbreaks and spread
  • 27. ILRI–Texas collaboration: Exporting live cattle and shoats and animal products: Ethiopia (2008) • Risk from properly handled carcasses, meat and meat products is negligible • Risk from live cattle or shoats introducing pathogens of concern is important
  • 28. LiveGene Delivering improved genetics to the world’s small-scale livestock keepers Targeting Gene Discovery Delivering Genetic Gains Prioritizing geography, environment, climate and social change, traits, species, breed. Adaptive alleles, characterization, conservation, Genome editing Digital recording platforms. Phenotyping and farmer feedback. Integrated data – comms, bio-repository, phenotyping, feedback, bioinformatics. Partnerships and networks Capacity Development
  • 29. New tools allow us to look in new places for sources of variation – including wildlife Comparative gene network and sequence analysis allows us to ask new kinds of questions about genomes – eg “what is different about this (group of) species compared to all other “traditional” linkage mapping requires crosses – so initial discovery is limited to variants within a species Cow NDama KFITRRPSLKTLQEKGLIKDQIFGSPLHTLCEREKSTVPRFVKQCIEAVEK Cow Boran KFITRRPSLKTLQEKGLIKDQIFGSHLHTLCEREKSTVPRFVKQCIEAVEK Human KFISRRPSLKTLQEKGLIKDQIFGSHLHTVCEREHSTVPWFVKQCIEAVEK Pig KFITRRPSLKTLQEKGLIKDQIFGSHLHTVCERENSTVPRFVKQCIEAVEK Chicken KFISRRPSLKTLQEKGLIKDQIFGSHLHLVCEHENSTVPQFVRQCIKAVER Salmon KFISRRPSMKTLQEKGIIKDRVFGCHLLALCEREGTTVPKFVRQCVEAVEK
  • 30. Genotype data is relatively cheap and easy to obtain: Phenotype data remains a challenge Can we skip a generation of technology? • Fast, light, cheap performance data harvesting. • Cheap sensors, mobile platforms, crowd sensing….. • Simultaneously providing management information to the farmer and performance data to the breeder.
  • 31. Identify and deliver variants associated with adaptation Genotyping Phenotyping Adapted & productive livestock Genome editing Targeting Data systems Delivery systems
  • 32. • 70% of production cost – FEED • 70% of feed – CROP RESIDUES • Potential huge demand for grain for MONOGASTRICS • Opportunities: – Improved crop residue quantity and quality – Improved use of crop residues with other feed resources – Balancing trade offs in biomass use – Use of sorghum and other alternates to maize for monogastrics Research-based livestock feed successes
  • 33. Feed opportunities • Produce more and better quality – Crop varieties with improved residue quality/quantity – Forages • Better use available feed – Via processing (chopping) – Feed mixtures (rations) • Import feed into the system – From areas of surplus to deficit – Concentrates • Potential environmental ‘win-win’
  • 34. ILRI–Texas collaborations in livestock and environment issues • Feed the Future Innovation Lab for Small-scale Irrigation - Exploring feed options • Use of systems models - Africa RISING - LIVES
  • 35. • Research evidence for smallholder dairying included: ﹣Risk analysis of informal milk marketing ﹣Employment and income benefits for the poor • Business/market development links poor livestock producers and feed suppliers to more sophisticated input/output systems ﹣A dairy ‘hub’ approach has been widely adopted Research-based livestock market successes
  • 36. Global greenhouse gas efficiency per kilogram of animal protein produced Large livestock production inefficiencies in the developing world present an opportunity Herrero et al PNAS (in press)
  • 37. GHG emissions to 2050 assuming developing countries do NOT improve their efficiencies 0 2 4 6 8 10 12 2007 estimate 2050 estimate 2050 estimate if all at 0.5l/day GHG emissions GT CO2 eq per annum assuming developed country levels remain at 1.3 kg/CO2 eq per kg milk while developing countries remain at 7.5 kg/CO2 eq per kg milk developing developed
  • 38. GHG emissions to 2050 assuming developing countries DO improve their efficiencies 0 2 4 6 8 10 12 2007 estimate 2050 estimate 2050 estimate if all at 0.5l/day GHG emissions GT CO2 eq per annum assuming both developed and developing country levels are at 1.3 kg/CO2 eq per kg milk developing developed
  • 39.
  • 40. Image credits Slide cover: (Left) Gond painting, 2012, by Kaushal Prasad Tekam (via Pinterest (Middle) Untitled, by Kalam Patua (via Asia Art Archive) (Right) Sacred cows, by Vidushini (via Novica) Slide #11: Sacred cows, by Vidushini (via Novica) Slide #12: Tingatinga painting (via InsideArtAfrica.com) Slide #14: Untitled, by Kalam Patua (via Asia Art Archive) Slide #16: Kalighat painting (via Pinterest)
  • 41. The presentation has a Creative Commons licence. You are free to re-use or distribute this work, provided credit is given to ILRI. better lives through livestock ilri.org Thank you!
  • 42. The presentation has a Creative Commons licence. You are free to re-use or distribute this work, provided credit is given to ILRI. better lives through livestock ilri.org