• Membre du corps professoral :
• Liens avec des intérêts commerciaux :
• ...
• Possibilité de conflits d’intérêts :
• Raymond Dattwyler et Biopeptides Corp. ont ...
1980 1990 2000 2010
Cibles antigènes : sonicats de cellules entières Bb ou Bb
• Problèmes :
• Les bactéries entières contie...
Premier mois de l’infection :
Première étape : Anticorps IgG et/ou IgM dirigé contre ...
1. Les critères ont été élaborés à l’aide de Bb de culture.
2. À l’époque où ces crit...
• Maladie aiguë au stade précoce : 30 à 40 %
• Maladie en phase de convalescence au stade...
Nowalk, A. J., R. D. Gilmore, Jr. et...
PROTÉINE MK Stade précoce Stade intermédiaire Stade tardif
P93 93 + +
• La réactivité croisée est un enjeu considérable dans tout essai biologique
de sérodiagn...
• P66 est un antigène proéminent
inclus dans la plupart des tests
sérologiques conventionnels de la
maladie de Lyme.
• Nou...
• Des peptides ont été générés à partir de séquence...
• Préservation de la spécificité par la sélection d’épitopes
propres à Borrelia spp., e...
• Le premier peptide approuvé par la Loi sur les aliments et drogue d’après l’essai
de sérodiagnostic.
• Un peptide con...
Signorino G, Arnaboldi PM, Petzke MM, Dattwyler RJ. Identification d’épitopes...
• Chaque peptide a été testé dans
un groupe de 114 cas de la
maladie de Lyme au stade
précoce, de 44 témoins en santé,
de ...
• La détermination de nouvelles cibles peptidiques se poursuit afin
• La formation d’anticorps prend du temps.
• Les niveaux de IgG restent élevés pendant des années après
l’infection, les t...
• Métabolomique
• Analyse des transcriptomes
• Suivi...
• Cinétique distincte des réponses des lymphocytes T
• Résolution suivante de l’infection :
• La...
• La plateforme technologique QuantiFERON
• Sang entier
• Incuber jusqu’au lendemain, prél...
• Les séquences pour chaque antigène ont
été évaluées par rapport aux bases de
données de protéines à l’a...
Sujets Âge médian
Sexe (F/M) Durée
médiane des
• Des IFNγ ont été détectés chez 3,1 % (6 sur 192) des
témoins en santé et des cas d’anaplasm...
IFNγ (UI) IgM ou IgG IgM ou IgG
Phase aiguë
• La sécrétion d’IFNγ peut être utilisée pour détecter l’infection causée par
Borrelia burgdorferi.
• Elle exige de...
• NIH NIAID pour le financement
• Biopeptides, Corp./NYMC
• Paul M. Arnaboldi, Ph. D.
• Mariya Sambir, maîtr...
Prochain SlideShare
Chargement dans…5

Français: Dr. Raymond J. Dattwyler

41 vues

Publié le

Les opinions exprimées dans ces exposés sont celles des auteurs et ne représentent pas nécessairement les points de vue du gouvernement du Canada. Les exposés sont diffusés dans leur format original, tel que nous les avons reçus des présentateurs.

Les exposés présentés lors de la Conférence en vue d’élaborer un cadre fédéral relatif à la maladie de Lyme sont la propriété de l’auteur, à moins d’indication contraire. Si vous faites référence au travail de l’auteur, vous devez nommer l’auteur et le titre de son exposé, ainsi que le lieu et la date de l’exposé.

Pour obtenir de plus amples renseignements, veuillez communiquer avec le secrétariat de la Conférence sur la maladie de Lyme à l’adresse maladie_lyme_disease@phac-aspc.gc.ca

Publié dans : Santé & Médecine
0 commentaire
0 j’aime
  • Soyez le premier à commenter

  • Soyez le premier à aimer ceci

Aucun téléchargement
Nombre de vues
Sur SlideShare
Issues des intégrations
Intégrations 0
Aucune incorporation

Aucune remarque pour cette diapositive

Français: Dr. Raymond J. Dattwyler

  1. 1. DIVULGATION DU CORPS PROFESSORAL/DE L’ANIMATEUR • Membre du corps professoral : • Liens avec des intérêts commerciaux : • La cartographie épitopique présentée a été effectuée par l’entreprise Biopeptides Corp. , et les droits de propriété intellectuelle sont détenus par cette dernière.
  2. 2. DIVULGATION DU FINANCEMENT COMMERCIAL • Possibilité de conflits d’intérêts : • Raymond Dattwyler et Biopeptides Corp. ont reçu des subventions de National Institutes Health (NIH). • L’entreprise Bio-Rad possède une technologie brevetée qui a été élaborée par Biopeptides Corp. • L’entreprise Qiagen possède une technologie brevetée qui a été élaborée par Biopeptides Corp.
  5. 5. Tests SÉROLOGIQUES Cibles antigènes : sonicats de cellules entières Bb ou Bb • Problèmes : • Les bactéries entières contiennent bon nombre d’épitopes qui sont communs parmi les autres espèces de bactéries – « des épitopes non spécifiques ». • Les Borrelia de culture peuvent perdre des antigènes codés par un plasmide. • Certains antigènes importants ne sont pas exprimés in vitro.
  6. 6. CRITÈRESDU CDC SÉROLOGIEENDEUXÉTAPES Premier mois de l’infection : Première étape : Anticorps IgG et/ou IgM dirigé contre le sonicat de cellule entière par essai immuno-enzymatique (EIA) ou immunofluorescence des anticorps (IFA) Deuxième étape : Transfert Western IgG et IgM si la première étape est positive ou équivoque 2 bandes d’anticorps IgM sur 3 : 23-, 39- et 41-kDa 5 bandes d’anticorps IgG sur 10 : 18-, 23-, 28-, 30-, 39-, 41-, 45-, 58-, 66- et 93-kDa Après le premier mois : Première étape : Anticorps IgG dirigé contre le sonicat de cellule entière par essai immuno-enzymatique (EIA) ou immunofluorescence des anticorps (IFA) Deuxième étape : Transfert Western IgG si la première étape est positive ou équivoque 5 bandes d’anticorps IgG sur 10 : 18-, 23-, 28-, 30-, 39-, 41-, 45-, 58-, 66- et 93-kDa
  7. 7. CRITÈRES LIÉS AUX TRANSFERTS WESTERN 1. Les critères ont été élaborés à l’aide de Bb de culture. 2. À l’époque où ces critères ont été formulés, nombre de ces antigènes n’étaient pas définis. 3. Les antigènes exprimés in vivo sont mal représentés. 7
  8. 8. SENSIBILITÉDESDEUXÉTAPESSTANDARD • Maladie aiguë au stade précoce : 30 à 40 % • Maladie en phase de convalescence au stade précoce : 70 % • Infection neurologique et cardite au stade précoce (aiguë disséminée) : 85 % • Maladie au stade tardif : plus de 98 %
  9. 9. INFECTION DISSÉMINÉE AU STADE TARDIF CHEZ L’HUMAIN PAR TRANSFERT WESTERN DE GEL EN 2D Nowalk, A. J., R. D. Gilmore, Jr. et J. A. Carroll. 2006. Analyse sérologique des protéomes des protéines associées à la membrane de Borrelia burgdorferi. Infect. Immun. 74:3864–3873.
  10. 10. ANTIGÈNES ASSOCIÉS AVEC LE TRANSFERT WESTERN 10 PROTÉINE MK Stade précoce Stade intermédiaire Stade tardif P93 93 + + Hsp90 90 + p66* 66 + OppA2 58 + ErpB 58 + BBK32 47 + FtsZ 45 + FlaB* 41 + BmpA 39 + BBO323* 30 + OspF 26 + + OspC 21 + LA7 20 + + ErpP 18 + + DbpA 18 + + RevA 18 +
  11. 11. RÉACTIVITÉ CROISÉE DES ANTIGÈNES • La réactivité croisée est un enjeu considérable dans tout essai biologique de sérodiagnostic, en particulier lors de l’utilisation de préparations provenant d’organismes complets ou de protéines bien conservées. • La flagelline de Borrelia génère des réponses positives chez plus de 40 % de personnes en bonne santé sans historique de maladie de Lyme (Liang, FT, et al., J. Clin. Microbiol., décembre 1999, vol. 37, no 12 3990-3996.) • Un antigène de 60 kDa est séropositif chez plus de 16 % des témoins en santé (Liang, FT, et al., J. Clin. Microbiol., décembre 1999, vol. 37, no 12 3990-3996.) • Souche homologue BBO323 avec des protéines de liaison de substrat périplasmique de microorganismes Gram négatif. • Les essais immuno-enzymatiques (ELISA) de sonicats de cellules entières peuvent détecter les anticorps à des taux supérieurs à 90 % dans des pays tropicaux exempts de la maladie de Lyme (Burkitt TR, et al., J Infect Dis. (1997) 175 (2): 466-469.)
  13. 13. • P66 est un antigène proéminent inclus dans la plupart des tests sérologiques conventionnels de la maladie de Lyme. • Nous avons découvert une quantité importante de liaison des anticorps à 6 peptides différents dans le sérum de témoins en santé et malades. • À ce sujet, nous constatons que la bande p66 de la plupart des transferts Western est positive quelle que soit la source du sérum. P66, une leçon de réactivité croisée.
  14. 14. D’AUTRES ANTIGÈNES POSSÈDENT ÉGALEMENT DES ÉPITOPES À RÉACTION CROISÉE • Des peptides ont été générés à partir de séquences d’épitopes OspC et de sérums de témoins en santé et chez lesquels la maladie de Lyme a été dépistée.
  15. 15. AVANTAGES DES ÉPITOPES DE PEPTIDES • Préservation de la spécificité par la sélection d’épitopes propres à Borrelia spp., et élimination d’épitopes à « réactivité croisée » présents chez d’autres espèces bactériennes. • Conceptuellement, ceci améliore la spécificité et la sensibilité des tests sérologiques.
  16. 16. C6 • Le premier peptide approuvé par la Loi sur les aliments et drogue d’après l’essai de sérodiagnostic. • Un peptide conservé provenant de la région invariable 6 de la protéine VIsE. • A donné de bons résultats comme test d’antigène seul; cependant, les résultats n’étaient pas assez bons pour remplacer le paradigme à deux étapes. • C6 ne se lie pas bien à IgM, il se lie principalement à IgG. • La région IR6 de VlsE est plus variable que ce que l’on pensait initialement, et les diagnostics basés sur les peptides sont extrêmement sensibles aux variances dans la séquence AA. • L’antigène VlsE n’est pas exprimé chez la tique (moins de 1 % des bactéries), c’est pourquoi il doit être régulé à la hausse pour produire une immunité, ce qui limite son utilité aux interventions très précoces. • Malgré les inconvénients observés, cela démontre clairement l’utilité des sérodiagnostics fondés sur les peptides.
  17. 17. CARTOGRAPHIE ÉPITOPIQUE de la protéine OppA2 Signorino G, Arnaboldi PM, Petzke MM, Dattwyler RJ. Identification d’épitopes linéaires de OppA2 comme marqueurs de sérodiagnostic pour la maladie de Lyme. Clin Vaccine Immunol.2014 May;21(5):704-11. • Pour OppA2, de nombreuses séquences ont été déterminées; pour d’autres protéines, seuls un ou deux épitopes ont été déterminés par protéine. Tableau 1. Séquences de peptides contenant des épitopes immunodominants de OppA2. Nom du peptide Séquence d’acides aminés OppA (11-25) IFFLTFLCCNNKERK OppA (191-225) YGQNWTNPENMVTSGPFKLKERIPNEKIVFEKNNK OppA (276-290) SDYYSSAVNAIYFYS OppA (276-300) SDYYSSAVNAIYFYSFNTHIKPLD OppA (286-300) IYFYSFNTHIKPLD OppA (286-310) IYFYSFNTHIKPLDNVKIRKALTLA OppA (356-375) LAEAGYPNGNGFPILKLKYN OppA (381-400) KKICEFIQNQWKKNLNIDVE OppA (491-505) APIYIYGNSYLFRND
  18. 18. • Chaque peptide a été testé dans un groupe de 114 cas de la maladie de Lyme au stade précoce, de 44 témoins en santé, de 30 témoins atteints de la polyarthrite rhumatoïde et de 28 tests des anticorps réaginiques positifs. • Les seuils de positivité ont été déterminés à plus de 3 ÉT par rapport à la moyenne des témoins en santé (positif) et à plus de 2 ÉT par rapport à la moyenne des témoins en santé (équivoque). ANALYSE ELISA DE OppA2
  19. 19. LEÇONS TIRÉES DE L’ÉLABORATION DES TESTS SÉROLOGIQUES • La détermination de nouvelles cibles peptidiques se poursuit afin d’améliorer la spécificité et la sensibilité par rapport aux essais immuno-enzymatiques (EIA) actuels de la première étape. • Cependant, la sélection des antigènes doit être effectuée avec soin. • Aucune « approche globale » n’est efficace pour la détermination des épitopes. • Chaque épitope provenant d’antigènes différents possède des attributs différents. • OspC1 se lie mieux à IgM qu’à IgG, DbpA4-DbpB6 ne fonctionne bien qu’en tant que dipeptide, de nombreux épitopes de p66 ont une réactivité croisée, p41 possède un épitope utile.
  20. 20. • La formation d’anticorps prend du temps. • Les niveaux de IgG restent élevés pendant des années après l’infection, les tests sérologiques ne peuvent distinguer une nouvelle infection d’une exposition préalable. • Les niveaux d’anticorps n’ont pas de corrélation avec la réussite du traitement. Les tests sérologiques présentent des problèmes impossibles à surmonter
  21. 21. NOUVELLES APPROCHES EN MATIÈRE DE DIAGNOSTIC EN LABORATOIRE L’AVENIR? • Métabolomique • Analyse des transcriptomes • Suivi de l’activité des lymphocytes T
  22. 22. RÉPONSE DES LYMPHOCYTES T • Cinétique distincte des réponses des lymphocytes T • Résolution suivante de l’infection : • La fonction effectrice des lymphocytes T s’estompe. • Les nombres de lymphocytes T activés se contractent. • La libération de cytokines peut être utilisée comme mesure indirecte de l’activation des lymphocytes T.
  23. 23. TEST DE LIBÉRATION DE CYTOKINES • La plateforme technologique QuantiFERON • Sang entier • Incuber jusqu’au lendemain, prélever du plasma • Essai d’immuno-absorption enzymatique IFN-γ Sans objet Maladie de LymeMito
  24. 24. ANTIGÈNES CIBLES • Les séquences pour chaque antigène ont été évaluées par rapport aux bases de données de protéines à l’aide du Basic Local Alignment Search Tool (BLAST) de NCBI. • Des bibliothèques de peptides qui se chevauchent ont été produites pour des régions avec : • moins de 50 % d’identité avec d’autres protéines et • plus de 80 % d’identité parmi Borrellia spp. • Ces données ont été générées à l’aide d’un mélange de 33 peptides issus de OspC, DbpB, p66 et FlaB. Antigènes évalués pour la réactivité des lymphocytes T : • OspC • DbpB • p66 • FlaB • CRASP2 • Bbk32 • BmpA • OppA2 • LA-7 • FlilB • Bdf2 • RecA
  25. 25. CARACTÉRISTIQUES DES PATIENTS Sujets Âge médian (intervalle) Sexe (F/M) Durée médiane des symptômes (intervalle) Symptômes d’un ou plusieurs érythèmes migrantsb Erythema migrans+a (n=29) 58 (19-74) 9/20 5 j. (2-30) 23/6 céphalées (n=23) raideur de la nuque (n=15) myalgie (n=15) fièvre (n=13) fatigue (n=13) arthralgie (n=10) lymphadénopathie (n=1) aucun (n=2) a- lésion ronde de plus de 5 cm, souvent avec un dégagement central partiel b- les symptômes se sont atténués après un traitement de 10 jours avec la doxycycline • Le sang a été prélevé lors de la visite initiale (n=29), 2 mois après le traitement (n=27) et 6 mois après le traitement (n=5).
  26. 26. SÉCRÉTION D’INTERFÉRON-GAMMA • Des IFNγ ont été détectés chez 3,1 % (6 sur 192) des témoins en santé et des cas d’anaplasmose. Phase aiguë Phase de convalescence (2 mois) Phase de convalescence (6 mois) Positif a 20/29 (69,0 %) IFNγ (UI/ml) 1,46 ± 2,26 4/27 (15,3 %) 1/5 (20,0 %) 0,27 ± 0,59 0,13 ± 0,19 a- >3 ÉT (0,33 UI/ml) par rapport à la moyenne d’IFN γ produits dans le sang de volontaires en santé ( n=187 ) et anaplasmose (n=5).
  27. 27. COMPARAISON AVEC LA SÉROLOGIE QuantiFERON ELISA C6 ELISA Transfert Western IFNγ (UI) IgM ou IgG IgM ou IgG Phase aiguë (n=29) 69,0 % (20/29) 58,6 % (17/29) 17,2 % (5/29) • Combinés, les analyses ELISA de C6 et de QuantiFERON ont déterminé positivement 82,8 % (24/29) des patients atteints de la maladie de Lyme en phase aiguë. • L’ajout de peptides provenant d’autres antigènes peut augmenter la sensibilité de l’essai biologique.
  28. 28. RÉSUMÉ • La sécrétion d’IFNγ peut être utilisée pour détecter l’infection causée par Borrelia burgdorferi. • Elle exige de multiples peptides provenant de différentes protéines. • La sécrétion d’IFNγ est réduite à la suite d’un traitement réussi aux antibiotiques. • Aucun patient ne s’est plaint de symptômes persistants à la suite du traitement à la doxycycline. • D’autres études garantiraient : • des valeurs limites définies de façon plus critique; • l’évaluation de l’inclusion d’autres antigènes; • l’évaluation de la maladie de Lyme localisée par rapport à la maladie disséminée; • l’évaluation du stade tardif de la maladie de Lyme.
  29. 29. REMERCIEMENTS • NIH NIAID pour le financement • Biopeptides, Corp./NYMC • Paul M. Arnaboldi, Ph. D. • Mariya Sambir, maîtrise ès sciences • NYMC • Mary Petzke, Ph. D. • Giacomo Signore, Ph. D. • Gary Wormser, M.D. • Gundersen-Lutheran, Wisc. • Steven Callister, Ph. D. • Dean Jobe, maîtrise ès sciences 29
