SlideShare a Scribd company logo
1 of 24
Molecular Drive in Bacterial Genomes (This talk is really about sex.) Rosie Redfield, UBC
The BIG question:  Do bacteria have sex? Definition of sex? Answer? Importance? Any process that produces recombinational variation Yes! Evolutionary effects Any process that evolved  for  recombinational variation Evolution of sex ?
To find out, we study DNA uptake in  Haemophilus influenzae . Do bacteria have parasexual processes because they generate recombinational variation? Transduction Conjugation DNA uptake (transformation) Physical recombination Donor cell Recipient cell
Animation by Matt Baumann DNA uptake by  H. influenzae :
Why else might bacteria take up DNA? DNA is good food. Serving size:  1-200kb Servings per genome: many Nucleotides  Bases Sugars Carbon Nitrogen Phosphorus High-energy electrons Not a significant source of fats, amino acids or vitamins 100%  50% 30% Yes  Yes Yes LOTS!
But...  if DNA is just used as food, why do bacteria prefer closely related DNAs? Three kinds of evidence: From theory:   Predicted benefits of nucleotides are much larger than benefits of recombination. From molecular biology:   Bacteria use nutritional signals to regulate DNA uptake.  From ecology:   DNA from diverse sources is very abundant in natural environments.
The motifs are very common in the genomes of the same bacteria.  e.g.  ~1471 perfect copies in  H. influenzae  (expect 8 in a random sequence) Some bacteria* preferentially take up DNAs with specific motifs. * Neisseria  and  Pasteurellaceae What makes DNA uptake self-specific?
About the  H. influenzae  preferred motif:  (Uptake Signal Sequence, USS) ,[object Object],[object Object],[object Object],[object Object],-1 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 core  flanking sequences  T G A C T T G G G T T T T T T T A A A A A T
H. influenzae  protein AAGTGCGGT gap gap gap SAV If USSs arise by insertion: AAGTGCGGT SAV SAL CAV SAI If USSs arise by mutation: Do USSs arise by copying and insertion? No, USSs arise by mutation. Only 24% of 100aa alignments have gaps anywhere.  Gaps are rare in USS-aligned positions. H. influenzae  protein Species with no USS Species with no USS
Consider polymorphism for one of the USS motifs: DNA uptake bias creates molecular drive: USS motif will accumulate even without selection. strongly favoured USS weakly favoured USS
Why would some DNA sequences be taken up more easily than others? Hypothesis:  Sequence bias arises from the mechanical difficulties of taking up DNA DNA must kink to enter the pore. outer membrane inner membrane
ComE (secretin) USS motifs may kink easily.
How strong is the  H. influenzae  uptake bias? Uptake relative to consensus USS At central positions, changing a single base of the motif reduces uptake by >90%. consensus base changed base
How strong does uptake bias need to be to drive accumulation of its motif in the genome? Factors to consider? Bias: Mutation rate - uptake specificity - availability of DNAs - recombination vs. degradation Factors can be evaluated with simulation models.
The model: Perfect consensus USS core Singly mismatched USS core mutation transformation Begin with random DNA  sequence Equilibrium reached  (mutation  transformation) Repeat many cycles
USS do not accumulate.  Random sequence Number of model cycles Bias = 0.1X mutation:  USS per kb Perfect USS cores Mutation = 0.001; Bias = 0.0001
USS per kilobase Range of perfect USS density in real genomes Range of one-off USS density in real genomes Singly mismatched USS cores Perfect USS cores Bias stronger than mutation drives accumulation of motifs in the genome. Random sequence Number of model cycles USS per kb Bias = 10X mutation:  Mutation = 0.0001; Bias = 0.001
HI0609 DILVVAVGKPNLISGDWIKE SAV VIDVGINRVD-GKLVGDVEF b0529 DLLIVAVGKPGFIPGDWIKEGAIVIDVGINRLENGKVVGDVVF VC1942 DILVVAVGKPNFIPGAWIKEGAVVVDVGINRLDTGKLVGDVEY PA1796 DLVVVAAGKPGLVKGEWIKEGAIVIDVGINRQADGRLVGDVEY *:::**.***.:: * ****.*:*:******  *::**** : AAGTGCGGT No USS How similar are these tripeptides to each other? How similar is the  H. influenzae  USS tripeptide to each of the others? Scoring coding constraints imposed by USS motifs Do USS motifs interfere with coding functions? Test by looking for reduced amino acid identity.
Compare unconstrained and USS-encoded tripeptides: Compare USS-encoded tripeptides to others Compare other tripeptides  USSs do not compromise coding function.
Summary: ,[object Object],[object Object],[object Object],[object Object],[object Object],Molecular drive explains uptake sequences in the  H. influenzae  genome.
How widespread are USS motifs? All  Neisseria? All  Pasteurellaceae No other bacteria. Most competent bacteria take up any DNA. Ambur  et al . 2007 J. Bacteriol.
Want more?  Our lab web pages include our grant proposals.
Want even more?  Check out our research blogs. Other   contributors: NRC Ottawa: Wendy Findlay John Nash Imperial College: Simon Kroll Janine Bosse
Recap: The big question:  Do bacteria have sex? * (*processes evolved for recombinational variation) The only serious candidate was competence. The only remaining issue was self-specific  DNA uptake. Uptake bias parsimoniously explains  genomic USSs and thus self-specificity. The answer:  No .   Arguing that bacteria take up DNA to get new genes is like arguing that a hungry man eats steak to get a cow gene that will let him live on grass.

More Related Content

What's hot

Macromolecule evolution
Macromolecule  evolutionMacromolecule  evolution
Macromolecule evolution
Paula Mills
 
Xenotransplantation
XenotransplantationXenotransplantation
Xenotransplantation
khehkesha
 

What's hot (20)

Introduction to the concept of genomics april quiapo ho maed2_s
Introduction to the concept of genomics april quiapo ho maed2_sIntroduction to the concept of genomics april quiapo ho maed2_s
Introduction to the concept of genomics april quiapo ho maed2_s
 
Diner_oyster
Diner_oysterDiner_oyster
Diner_oyster
 
B27 the human genome
 B27 the human genome B27 the human genome
B27 the human genome
 
20110919 beyond genome
20110919 beyond genome20110919 beyond genome
20110919 beyond genome
 
Macromolecule evolution
Macromolecule  evolutionMacromolecule  evolution
Macromolecule evolution
 
Genetic variation and evolution and their importance to medicine
Genetic variation and evolution and their importance to medicineGenetic variation and evolution and their importance to medicine
Genetic variation and evolution and their importance to medicine
 
Vision Research Symposium Conference Presentation
Vision Research Symposium Conference PresentationVision Research Symposium Conference Presentation
Vision Research Symposium Conference Presentation
 
Bacterial genetics
Bacterial geneticsBacterial genetics
Bacterial genetics
 
Genetic variation
Genetic variationGenetic variation
Genetic variation
 
BIOL335: Genetic selection
BIOL335: Genetic selectionBIOL335: Genetic selection
BIOL335: Genetic selection
 
Genetic recombination in bacteria
Genetic recombination in bacteriaGenetic recombination in bacteria
Genetic recombination in bacteria
 
Genetic variation and its role in health pharmacology
Genetic variation and its role in health pharmacologyGenetic variation and its role in health pharmacology
Genetic variation and its role in health pharmacology
 
Genetics varaiation.1
Genetics varaiation.1Genetics varaiation.1
Genetics varaiation.1
 
Nwabr ethics jan 11
Nwabr ethics jan 11Nwabr ethics jan 11
Nwabr ethics jan 11
 
Seminario biología molecular
Seminario biología molecular Seminario biología molecular
Seminario biología molecular
 
Genetics of bacteria
Genetics of bacteriaGenetics of bacteria
Genetics of bacteria
 
Xenotransplantation
XenotransplantationXenotransplantation
Xenotransplantation
 
Methods for producing transgenic animals
Methods for producing transgenic animalsMethods for producing transgenic animals
Methods for producing transgenic animals
 
Molecular evolution
Molecular evolutionMolecular evolution
Molecular evolution
 
Neutral theory of evolution
Neutral theory of evolutionNeutral theory of evolution
Neutral theory of evolution
 

Viewers also liked (20)

Corazon
CorazonCorazon
Corazon
 
Ppt De Prueba
Ppt De PruebaPpt De Prueba
Ppt De Prueba
 
Para Ti Cosa
Para Ti CosaPara Ti Cosa
Para Ti Cosa
 
Presentacion Para El Blog
Presentacion Para El BlogPresentacion Para El Blog
Presentacion Para El Blog
 
Golfly Sales Kit 0620short
Golfly Sales Kit 0620shortGolfly Sales Kit 0620short
Golfly Sales Kit 0620short
 
Para Ti
Para TiPara Ti
Para Ti
 
Manzanitas
ManzanitasManzanitas
Manzanitas
 
Dia Internacionaldel Hombre
Dia Internacionaldel HombreDia Internacionaldel Hombre
Dia Internacionaldel Hombre
 
Corazon
CorazonCorazon
Corazon
 
La Mariposayla Flor
La Mariposayla FlorLa Mariposayla Flor
La Mariposayla Flor
 
Tiposdemujeresfaciles
TiposdemujeresfacilesTiposdemujeresfaciles
Tiposdemujeresfaciles
 
El Verdaddero Amor
El Verdaddero AmorEl Verdaddero Amor
El Verdaddero Amor
 
Unerrorenelcielo
UnerrorenelcieloUnerrorenelcielo
Unerrorenelcielo
 
SueñOs
SueñOsSueñOs
SueñOs
 
Las Cruzadas
Las CruzadasLas Cruzadas
Las Cruzadas
 
別說不可能 約翰庫緹斯
別說不可能 約翰庫緹斯別說不可能 約翰庫緹斯
別說不可能 約翰庫緹斯
 
Cartel
CartelCartel
Cartel
 
Global Warming H A I R E R
Global Warming  H A I R E RGlobal Warming  H A I R E R
Global Warming H A I R E R
 
The Western Wall Glass Sculpture Project
The Western Wall  Glass Sculpture ProjectThe Western Wall  Glass Sculpture Project
The Western Wall Glass Sculpture Project
 
The Treaty Of Waitangi
The Treaty Of WaitangiThe Treaty Of Waitangi
The Treaty Of Waitangi
 

Similar to R. Redfield's SMBE talk slides

genetic variations
genetic variationsgenetic variations
genetic variations
gueste52e15
 
Bacterial genetics
Bacterial geneticsBacterial genetics
Bacterial genetics
Bruno Mmassy
 
Nuclear Genomes(Short Answers and questions)
Nuclear Genomes(Short Answers and questions)Nuclear Genomes(Short Answers and questions)
Nuclear Genomes(Short Answers and questions)
Zohaib HUSSAIN
 

Similar to R. Redfield's SMBE talk slides (20)

Louisville2
Louisville2Louisville2
Louisville2
 
Do My Biology Assignment
Do My Biology AssignmentDo My Biology Assignment
Do My Biology Assignment
 
Como afrontar células madre de cáncer con alimentos
Como afrontar células madre de cáncer con  alimentos Como afrontar células madre de cáncer con  alimentos
Como afrontar células madre de cáncer con alimentos
 
Pertemuan 1. introduction
Pertemuan 1. introductionPertemuan 1. introduction
Pertemuan 1. introduction
 
genetic variations
genetic variationsgenetic variations
genetic variations
 
Secondary cell culture
Secondary cell cultureSecondary cell culture
Secondary cell culture
 
Transgenic.pptx
Transgenic.pptxTransgenic.pptx
Transgenic.pptx
 
مشروووووع الوراثه
مشروووووع الوراثهمشروووووع الوراثه
مشروووووع الوراثه
 
Lec13. plasmid and episom
Lec13. plasmid and episomLec13. plasmid and episom
Lec13. plasmid and episom
 
Cancer by DR. Ashfaq Afridi
Cancer by DR. Ashfaq AfridiCancer by DR. Ashfaq Afridi
Cancer by DR. Ashfaq Afridi
 
Microevolution
MicroevolutionMicroevolution
Microevolution
 
Microbial genomes.ppt
Microbial genomes.pptMicrobial genomes.ppt
Microbial genomes.ppt
 
Genomics Technologies
Genomics TechnologiesGenomics Technologies
Genomics Technologies
 
e. coli
e. colie. coli
e. coli
 
Bacterial genetics
Bacterial geneticsBacterial genetics
Bacterial genetics
 
Bacterial genetics
Bacterial geneticsBacterial genetics
Bacterial genetics
 
Mechanisms of Evolution: Population Selection and Change
Mechanisms of Evolution: Population Selection and ChangeMechanisms of Evolution: Population Selection and Change
Mechanisms of Evolution: Population Selection and Change
 
U1 and U2 Exam Review from 28May
U1 and U2 Exam Review from 28MayU1 and U2 Exam Review from 28May
U1 and U2 Exam Review from 28May
 
Genotyping, linkage mapping and binary data
Genotyping, linkage mapping and binary dataGenotyping, linkage mapping and binary data
Genotyping, linkage mapping and binary data
 
Nuclear Genomes(Short Answers and questions)
Nuclear Genomes(Short Answers and questions)Nuclear Genomes(Short Answers and questions)
Nuclear Genomes(Short Answers and questions)
 

Recently uploaded

Architecting Cloud Native Applications
Architecting Cloud Native ApplicationsArchitecting Cloud Native Applications
Architecting Cloud Native Applications
WSO2
 
Modular Monolith - a Practical Alternative to Microservices @ Devoxx UK 2024
Modular Monolith - a Practical Alternative to Microservices @ Devoxx UK 2024Modular Monolith - a Practical Alternative to Microservices @ Devoxx UK 2024
Modular Monolith - a Practical Alternative to Microservices @ Devoxx UK 2024
Victor Rentea
 
Cloud Frontiers: A Deep Dive into Serverless Spatial Data and FME
Cloud Frontiers:  A Deep Dive into Serverless Spatial Data and FMECloud Frontiers:  A Deep Dive into Serverless Spatial Data and FME
Cloud Frontiers: A Deep Dive into Serverless Spatial Data and FME
Safe Software
 
Cloud Frontiers: A Deep Dive into Serverless Spatial Data and FME
Cloud Frontiers:  A Deep Dive into Serverless Spatial Data and FMECloud Frontiers:  A Deep Dive into Serverless Spatial Data and FME
Cloud Frontiers: A Deep Dive into Serverless Spatial Data and FME
Safe Software
 
+971581248768>> SAFE AND ORIGINAL ABORTION PILLS FOR SALE IN DUBAI AND ABUDHA...
+971581248768>> SAFE AND ORIGINAL ABORTION PILLS FOR SALE IN DUBAI AND ABUDHA...+971581248768>> SAFE AND ORIGINAL ABORTION PILLS FOR SALE IN DUBAI AND ABUDHA...
+971581248768>> SAFE AND ORIGINAL ABORTION PILLS FOR SALE IN DUBAI AND ABUDHA...
?#DUbAI#??##{{(☎️+971_581248768%)**%*]'#abortion pills for sale in dubai@
 

Recently uploaded (20)

Manulife - Insurer Transformation Award 2024
Manulife - Insurer Transformation Award 2024Manulife - Insurer Transformation Award 2024
Manulife - Insurer Transformation Award 2024
 
Connector Corner: Accelerate revenue generation using UiPath API-centric busi...
Connector Corner: Accelerate revenue generation using UiPath API-centric busi...Connector Corner: Accelerate revenue generation using UiPath API-centric busi...
Connector Corner: Accelerate revenue generation using UiPath API-centric busi...
 
Apidays New York 2024 - The Good, the Bad and the Governed by David O'Neill, ...
Apidays New York 2024 - The Good, the Bad and the Governed by David O'Neill, ...Apidays New York 2024 - The Good, the Bad and the Governed by David O'Neill, ...
Apidays New York 2024 - The Good, the Bad and the Governed by David O'Neill, ...
 
"I see eyes in my soup": How Delivery Hero implemented the safety system for ...
"I see eyes in my soup": How Delivery Hero implemented the safety system for ..."I see eyes in my soup": How Delivery Hero implemented the safety system for ...
"I see eyes in my soup": How Delivery Hero implemented the safety system for ...
 
Artificial Intelligence Chap.5 : Uncertainty
Artificial Intelligence Chap.5 : UncertaintyArtificial Intelligence Chap.5 : Uncertainty
Artificial Intelligence Chap.5 : Uncertainty
 
Apidays New York 2024 - APIs in 2030: The Risk of Technological Sleepwalk by ...
Apidays New York 2024 - APIs in 2030: The Risk of Technological Sleepwalk by ...Apidays New York 2024 - APIs in 2030: The Risk of Technological Sleepwalk by ...
Apidays New York 2024 - APIs in 2030: The Risk of Technological Sleepwalk by ...
 
Apidays New York 2024 - Scaling API-first by Ian Reasor and Radu Cotescu, Adobe
Apidays New York 2024 - Scaling API-first by Ian Reasor and Radu Cotescu, AdobeApidays New York 2024 - Scaling API-first by Ian Reasor and Radu Cotescu, Adobe
Apidays New York 2024 - Scaling API-first by Ian Reasor and Radu Cotescu, Adobe
 
presentation ICT roal in 21st century education
presentation ICT roal in 21st century educationpresentation ICT roal in 21st century education
presentation ICT roal in 21st century education
 
Spring Boot vs Quarkus the ultimate battle - DevoxxUK
Spring Boot vs Quarkus the ultimate battle - DevoxxUKSpring Boot vs Quarkus the ultimate battle - DevoxxUK
Spring Boot vs Quarkus the ultimate battle - DevoxxUK
 
Architecting Cloud Native Applications
Architecting Cloud Native ApplicationsArchitecting Cloud Native Applications
Architecting Cloud Native Applications
 
Apidays New York 2024 - Accelerating FinTech Innovation by Vasa Krishnan, Fin...
Apidays New York 2024 - Accelerating FinTech Innovation by Vasa Krishnan, Fin...Apidays New York 2024 - Accelerating FinTech Innovation by Vasa Krishnan, Fin...
Apidays New York 2024 - Accelerating FinTech Innovation by Vasa Krishnan, Fin...
 
Modular Monolith - a Practical Alternative to Microservices @ Devoxx UK 2024
Modular Monolith - a Practical Alternative to Microservices @ Devoxx UK 2024Modular Monolith - a Practical Alternative to Microservices @ Devoxx UK 2024
Modular Monolith - a Practical Alternative to Microservices @ Devoxx UK 2024
 
2024: Domino Containers - The Next Step. News from the Domino Container commu...
2024: Domino Containers - The Next Step. News from the Domino Container commu...2024: Domino Containers - The Next Step. News from the Domino Container commu...
2024: Domino Containers - The Next Step. News from the Domino Container commu...
 
Cloud Frontiers: A Deep Dive into Serverless Spatial Data and FME
Cloud Frontiers:  A Deep Dive into Serverless Spatial Data and FMECloud Frontiers:  A Deep Dive into Serverless Spatial Data and FME
Cloud Frontiers: A Deep Dive into Serverless Spatial Data and FME
 
CNIC Information System with Pakdata Cf In Pakistan
CNIC Information System with Pakdata Cf In PakistanCNIC Information System with Pakdata Cf In Pakistan
CNIC Information System with Pakdata Cf In Pakistan
 
Cloud Frontiers: A Deep Dive into Serverless Spatial Data and FME
Cloud Frontiers:  A Deep Dive into Serverless Spatial Data and FMECloud Frontiers:  A Deep Dive into Serverless Spatial Data and FME
Cloud Frontiers: A Deep Dive into Serverless Spatial Data and FME
 
Rising Above_ Dubai Floods and the Fortitude of Dubai International Airport.pdf
Rising Above_ Dubai Floods and the Fortitude of Dubai International Airport.pdfRising Above_ Dubai Floods and the Fortitude of Dubai International Airport.pdf
Rising Above_ Dubai Floods and the Fortitude of Dubai International Airport.pdf
 
+971581248768>> SAFE AND ORIGINAL ABORTION PILLS FOR SALE IN DUBAI AND ABUDHA...
+971581248768>> SAFE AND ORIGINAL ABORTION PILLS FOR SALE IN DUBAI AND ABUDHA...+971581248768>> SAFE AND ORIGINAL ABORTION PILLS FOR SALE IN DUBAI AND ABUDHA...
+971581248768>> SAFE AND ORIGINAL ABORTION PILLS FOR SALE IN DUBAI AND ABUDHA...
 
[BuildWithAI] Introduction to Gemini.pdf
[BuildWithAI] Introduction to Gemini.pdf[BuildWithAI] Introduction to Gemini.pdf
[BuildWithAI] Introduction to Gemini.pdf
 
Corporate and higher education May webinar.pptx
Corporate and higher education May webinar.pptxCorporate and higher education May webinar.pptx
Corporate and higher education May webinar.pptx
 

R. Redfield's SMBE talk slides

  • 1. Molecular Drive in Bacterial Genomes (This talk is really about sex.) Rosie Redfield, UBC
  • 2. The BIG question: Do bacteria have sex? Definition of sex? Answer? Importance? Any process that produces recombinational variation Yes! Evolutionary effects Any process that evolved for recombinational variation Evolution of sex ?
  • 3. To find out, we study DNA uptake in Haemophilus influenzae . Do bacteria have parasexual processes because they generate recombinational variation? Transduction Conjugation DNA uptake (transformation) Physical recombination Donor cell Recipient cell
  • 4. Animation by Matt Baumann DNA uptake by H. influenzae :
  • 5. Why else might bacteria take up DNA? DNA is good food. Serving size: 1-200kb Servings per genome: many Nucleotides Bases Sugars Carbon Nitrogen Phosphorus High-energy electrons Not a significant source of fats, amino acids or vitamins 100% 50% 30% Yes Yes Yes LOTS!
  • 6. But... if DNA is just used as food, why do bacteria prefer closely related DNAs? Three kinds of evidence: From theory: Predicted benefits of nucleotides are much larger than benefits of recombination. From molecular biology: Bacteria use nutritional signals to regulate DNA uptake. From ecology: DNA from diverse sources is very abundant in natural environments.
  • 7. The motifs are very common in the genomes of the same bacteria. e.g. ~1471 perfect copies in H. influenzae (expect 8 in a random sequence) Some bacteria* preferentially take up DNAs with specific motifs. * Neisseria and Pasteurellaceae What makes DNA uptake self-specific?
  • 8.
  • 9. H. influenzae protein AAGTGCGGT gap gap gap SAV If USSs arise by insertion: AAGTGCGGT SAV SAL CAV SAI If USSs arise by mutation: Do USSs arise by copying and insertion? No, USSs arise by mutation. Only 24% of 100aa alignments have gaps anywhere. Gaps are rare in USS-aligned positions. H. influenzae protein Species with no USS Species with no USS
  • 10. Consider polymorphism for one of the USS motifs: DNA uptake bias creates molecular drive: USS motif will accumulate even without selection. strongly favoured USS weakly favoured USS
  • 11. Why would some DNA sequences be taken up more easily than others? Hypothesis: Sequence bias arises from the mechanical difficulties of taking up DNA DNA must kink to enter the pore. outer membrane inner membrane
  • 12. ComE (secretin) USS motifs may kink easily.
  • 13. How strong is the H. influenzae uptake bias? Uptake relative to consensus USS At central positions, changing a single base of the motif reduces uptake by >90%. consensus base changed base
  • 14. How strong does uptake bias need to be to drive accumulation of its motif in the genome? Factors to consider? Bias: Mutation rate - uptake specificity - availability of DNAs - recombination vs. degradation Factors can be evaluated with simulation models.
  • 15. The model: Perfect consensus USS core Singly mismatched USS core mutation transformation Begin with random DNA sequence Equilibrium reached (mutation transformation) Repeat many cycles
  • 16. USS do not accumulate. Random sequence Number of model cycles Bias = 0.1X mutation: USS per kb Perfect USS cores Mutation = 0.001; Bias = 0.0001
  • 17. USS per kilobase Range of perfect USS density in real genomes Range of one-off USS density in real genomes Singly mismatched USS cores Perfect USS cores Bias stronger than mutation drives accumulation of motifs in the genome. Random sequence Number of model cycles USS per kb Bias = 10X mutation: Mutation = 0.0001; Bias = 0.001
  • 18. HI0609 DILVVAVGKPNLISGDWIKE SAV VIDVGINRVD-GKLVGDVEF b0529 DLLIVAVGKPGFIPGDWIKEGAIVIDVGINRLENGKVVGDVVF VC1942 DILVVAVGKPNFIPGAWIKEGAVVVDVGINRLDTGKLVGDVEY PA1796 DLVVVAAGKPGLVKGEWIKEGAIVIDVGINRQADGRLVGDVEY *:::**.***.:: * ****.*:*:****** *::**** : AAGTGCGGT No USS How similar are these tripeptides to each other? How similar is the H. influenzae USS tripeptide to each of the others? Scoring coding constraints imposed by USS motifs Do USS motifs interfere with coding functions? Test by looking for reduced amino acid identity.
  • 19. Compare unconstrained and USS-encoded tripeptides: Compare USS-encoded tripeptides to others Compare other tripeptides USSs do not compromise coding function.
  • 20.
  • 21. How widespread are USS motifs? All Neisseria? All Pasteurellaceae No other bacteria. Most competent bacteria take up any DNA. Ambur et al . 2007 J. Bacteriol.
  • 22. Want more? Our lab web pages include our grant proposals.
  • 23. Want even more? Check out our research blogs. Other contributors: NRC Ottawa: Wendy Findlay John Nash Imperial College: Simon Kroll Janine Bosse
  • 24. Recap: The big question: Do bacteria have sex? * (*processes evolved for recombinational variation) The only serious candidate was competence. The only remaining issue was self-specific DNA uptake. Uptake bias parsimoniously explains genomic USSs and thus self-specificity. The answer: No . Arguing that bacteria take up DNA to get new genes is like arguing that a hungry man eats steak to get a cow gene that will let him live on grass.

Editor's Notes

  1. Subtitle to make sure big picture doesn’t get lost in the details.