SlideShare une entreprise Scribd logo
1  sur  30
Télécharger pour lire hors ligne
Adult Immunization
Dr Banu chander pandian. S
DNB FAMILY MEDICINE
KG HOSPITAL
6/23/2017 1
Definition
• Immunization refers to the artificial
induction of immunity. It can be by
Active Immunization: the use of live
attenuated infectious agents or
inactivated toxins, or antigens obtained
by genetic recombination OR
Passive Immunization: temporary
immunity obtained by the administration
of immunoglobulins or antitoxins.
6/23/2017 2
Is it immunisation helpful
• Smallpox eradicated in 1978 from
India
• polio eradication.
• Infant/Childhood immunization –
one of the top public health success
stories of the 20th century
• The prevalence of Diphtheria,
Pertussis, tetanus, measles, mumps,
rubella, poliomyelitis are reduced.
6/23/2017 4
Why Adult Immunization ???
• Build on success of infant/childhood, adolescent
immunization program.
• Not vaccinated earlier, booster.
• New vaccines targeted at adults.
• Ageing : more susceptible.
• Increasing Antimicrobial Resistance.
• Recognition of the burden of adult vaccine-
preventable disease.
• No equivalent “Vaccines for Adults” program.
6/23/2017 5
Adult Immunization recommended in
india
Tdap MMR
Influenza Pneumococcal
Hepatitis B Hepatitis A
Varicella HPV (cervical cancer)
Meningococcal Herpes Zoster
6/23/2017 6
Diphtheria, Tetanus, Pertussis
Vaccines
• Two Tdap Vaccines are available for use in those
who are more than 10 years of age.
-Efficacy of Tdap vaccine - 92%
Recommendations
- for all adults who have not received Tdap or for
whom vaccine status is not known
6/23/2017 7
Measles, Mumps And Rubella
Vaccines
• In India the measles, mumps, rubella (MMR) live
attenuated vaccine is manufactured using the
following strains:
• The measles and the rubella components are
produced using human diploid cells while the
mumps component is produced from chick
embryo.
• The MMR vaccine should be administered
subcutaneously into the upper arm.
6/23/2017 8
Indications
• Adolesents and adults
• Women of childbearing age who is not
pregnant
FREQUENCY
• Two doses at interval of 4 weeks
• Subcutaneously in upper arm
Varicella (Chickenpox)
6/23/2017 10
Vaccines
• Two Live attenuated VZV (Oka strain)
vaccines for varicella virus are
currently available in India.
– Varilrix (GlaxoSmithKline, Belgium) and
– Okavax (Pasteur Mérieux, France).
Schedule
- Interval between 2 doses should be 4–
8wks.
Recommendations
• All susceptible adults and adolescents should
be vaccinated.(18-49yrs)
• It is especially important to susceptible
persons
– Health care workers
– Family contacts of immunocompromised persons
– High risk of exposure (e.g., teachers, day care
employees, military personnel, and international
travelers).
6/23/2017 11
Human Papilloma Virus
• Papilloma virus infection is precursor to cervical
cancer
– Types 16, 18 account for 70% of cervical
cancers
Vaccines
• Two types HPV vaccines are available.
– Gardasil (Merck, USA), a quadrivalent vaccine
containing HPV virus L1 protein like particles of
HPV 6,11,16, and 18
– Cervarix (GlaxoSmithKline, Belgium) is a
bivalent vaccine containing L1 VLPs of HPV
16,18.
6/23/2017 12
Recommendations
• The vaccine has to be delivered prior to
exposure to the HPV virus. Therefore, the
immunization must precede the sexual debut.
• Age for initiation for vaccination to be 10 - 12
years.
• Catch-up vaccination can be advised up to the
age of 26 years for Gardasil vaccine and 45
years for Cervarix vaccine.
6/23/2017 14
• Schedule
– BHPV – 0,1,6 months
– QHPV – 0,2,6 months
For male HPV 4 is recommanded
Hepatitis B
Vaccines
• For immunocompetent adults, 1ml (20 μg) of
recombinant vaccine is administered at 0, 1, and 6
months as an intramuscular.
• Protection (anti-HBs antibody titer of 10mIU/ml or
higher) after recombinant vaccine
– After first dose - 20% to 30%
– After second dose - 75% to 80%
– After third doses - 90% to 95%
Recommendations
• All unvaccinated adult risk for HBV infection and
• All adults seeking protection from HBV infection
including post-exposure prophylaxis.
6/23/2017 16
• Booster doses of HBV vaccine are not
indicated in persons with normal immune
status .
• For CKD patients, the need for booster
doses should be assessed by annual anti-
HBs antibody titre testing.
• A booster dose should be administered
when anti-HBs levels decline to less than 10
mIU/ml & <100 mIU/ml in patients on
dialysis.
.
6/23/2017 17
6/23/2017 18
Hepatitis A
Vaccines
• Inactivated-single antigen (HAV antigen) vaccines,
– Havrix (GlaxoSmithKline) and
– Vaqta (Merck & Co)
– Dose : 1440ELU
Schedule
• Two doses of 1ml at 6 month interval.
• Immune status for hepatitis A should be checked
6/23/2017 19
Pneumococcal Infection
Vaccines
Two types
• The pneumococcal polysaccharide
vaccine (PPV23), contains 25 μg each of
purified capsular polysaccharide from 23
serotypes of Streptococcus pneumoniae.
• Pneumococcal conjugate vaccine (PCV 13)
– This vaccine can be co-administered with
live vaccines such as the influenza
vaccine.
6/23/2017 20
Schedule
–A single standard dose (0.5 ml) is
administered by the intramuscular or
subcutaneous route.
–Revaccination: 0.5ml IM or SC at least
after 5 years of 1st dose in case of High
risk people.
6/23/2017 21
Influenza
Vaccines
– Trivalent inactivated influenza vaccine (TIV) and
– Live attenuated influenza vaccine (LAIV)
• The TIV contains
– A/17/California/2009/38(H1N1),
– A/Brisbane/ 10/2007 (H3N2), and
– B/Brisbane/60/2008 strains.
• Live attenuated influenza vaccine (LAIV) –
Nasovac contains
– A/17/California/2009/38 like strain
• Schedule
– The TIV - annual, single dose of 0.5 ml IM.
– The LAIV – 0.5 ml intranasal (spray 0.25 ml per
nostril)
6/23/2017 22
Meningococcal Meningitis
Vaccines
• Types
– Polysaccharide vaccines
• Bivalent (A&C)
• Quadrivalent (A,C,Y & W135)
– Conjugate vaccines.
• The vaccine does not induce herd immunity
and has no effect on nasopharyngeal
carriage.
• Containing 50 μg of polysaccharide per dose.
• After reconstitution use within 8-12 hours.
6/23/2017 23
Schedule
• A single dose of 0.5 ml SC in deltoid region.
• Used in selected population
• Age 2- 3 yrs
• Congenital deficiencs in complement
components
• Travellers to hajj
• Lab persons
6/23/2017 24
Documentation
• Provide copy of Vaccine
Information Statement (VIS)to
patient
• Documents to be maintained
– Date vaccination & next dose
– Vaccine manufacturer
– Lot number
– Dose & site of vaccine
6/23/2017 25
Vaccine Administration
• Health care personnel should get proper
training before administrating vaccine.
• Always prepare and check the following for
every vaccination you give:
– Right Patient
– Right Drug (vaccine)
– Right Dose
– Right Route (intramuscular, SC,intradermal)
– Right Time (is scheduling correct)
6/23/2017 26
Vaccine / Age group 19-26 yrs 27-49 yrs 50-59 yrs 60-64 yrs > 65 yrs
Tetanus, Diptheria, Pertussis (Tdap)
Substitude one time dose of Tdap with Td,
then booster with Td every 10 years
Td booster
every 10 yrs
Human Papiloma Vaccine 3 doses
Varicella 2 doses
Zoster 1 dose
Measles, Mumps, Rubella 1 or 2 doses 1 dose
Influenza 1 dose annually
Pnemococcal (Polysaccharide) 1 or 2 doses 1 dose
Hepatitis A 2 doses
Hepatitis B 3 doses
Meninngicoccal 1 or more doses
6/23/2017 27
ACIP Adult Immunization Schedule, Age-Based Recommendations, INDIA
Recommended if some risk factor is present
All persons who meet the age criteria
No recommendation
6/23/2017 28
Adult Immunization based on medical and other indications (INDIA)
Indications
Pregnancy
Immunoco
mpromise
d
conditions
(Excluding
HIV)
HIV infection
with CD4
count
Diabetes,
heart
disease,
chronic
lung
disease
Asplenia
(excluding
elective
splenectomy
)
Chronic
liver
disease
Kidney
failure, end
stage renal
disease, on
hemodialysi
s
Health
care
professi
onals
Vaccine <200
cells/ µl
>200
cells/ µl
Tetanus, Diptheria,
Pertussis (Tdap)
Td
Substitute one time dose of Tdap with Td, then booster with Td every 10
years
Human Pappiloma
Vaccine
3 doses for females through age 26 years
Varicella Contraindication 2 doses
Zoster Contraindication 1 dose
Measles, Mumps, Rubella Contraindication 1 or 2 doses
Influenza 1 dose TIV annually 1 dose TIV
or LAIV
Pnemococcal
(Polysaccharide)
1 or 2 doses
Hepatitis A 2 doses
Hepatitis B 3 doses
Meninngicoccal 1 or more doses
Recommended if some risk factor is present
All persons who meet the age criteria
Contraindication
Immunization in adult
Immunization in adult

Contenu connexe

Similaire à Immunization in adult

Adult immunisation
Adult immunisationAdult immunisation
Adult immunisationDR RML DELHI
 
DR JRK ADULT IMMUNIZATION programme.pptx
DR JRK ADULT IMMUNIZATION programme.pptxDR JRK ADULT IMMUNIZATION programme.pptx
DR JRK ADULT IMMUNIZATION programme.pptxsolankiumesh45
 
Human vaccinations ppt by dr. hussein abass
Human vaccinations  ppt by dr. hussein abassHuman vaccinations  ppt by dr. hussein abass
Human vaccinations ppt by dr. hussein abassHosin Abass
 
Vaccination of healthcare workers, Dr. V. Anil Kumar
Vaccination of healthcare workers, Dr. V. Anil KumarVaccination of healthcare workers, Dr. V. Anil Kumar
Vaccination of healthcare workers, Dr. V. Anil Kumarohscmcvellore
 
Vaccination of pregnant women and health care workers - Slideset by Professor...
Vaccination of pregnant women and health care workers - Slideset by Professor...Vaccination of pregnant women and health care workers - Slideset by Professor...
Vaccination of pregnant women and health care workers - Slideset by Professor...WAidid
 
Human vaccinations in egypt 2021
Human vaccinations in egypt   2021Human vaccinations in egypt   2021
Human vaccinations in egypt 2021HusseinAbass1
 
Immunization in adults, geriatrics and paediatrics.
Immunization in adults, geriatrics and paediatrics.Immunization in adults, geriatrics and paediatrics.
Immunization in adults, geriatrics and paediatrics.Milancpatel
 
Chicken pox vaccine presentation jalandhar july 2017
Chicken pox vaccine presentation jalandhar july 2017Chicken pox vaccine presentation jalandhar july 2017
Chicken pox vaccine presentation jalandhar july 2017Gaurav Gupta
 
LATEST IAP GUIDELINES OF IMMUNISATION
LATEST IAP GUIDELINES OF IMMUNISATION LATEST IAP GUIDELINES OF IMMUNISATION
LATEST IAP GUIDELINES OF IMMUNISATION Dr Jishnu KR
 
Bacterialvaccine (1).ppt
Bacterialvaccine (1).pptBacterialvaccine (1).ppt
Bacterialvaccine (1).pptVandanaVats8
 
NEWER VACCINE PPT.ppt
NEWER VACCINE PPT.pptNEWER VACCINE PPT.ppt
NEWER VACCINE PPT.pptjyothi132223
 
finalnewervaccinesakhileshppt-210521062533(3)(1).pptx
finalnewervaccinesakhileshppt-210521062533(3)(1).pptxfinalnewervaccinesakhileshppt-210521062533(3)(1).pptx
finalnewervaccinesakhileshppt-210521062533(3)(1).pptxjyothi132223
 
Immunisations and kidney transplantation
Immunisations and kidney transplantationImmunisations and kidney transplantation
Immunisations and kidney transplantationAjay Kurian
 
Immunisation programme.pptx
Immunisation programme.pptxImmunisation programme.pptx
Immunisation programme.pptxssuser38ed4c2
 

Similaire à Immunization in adult (20)

Adult immunisation
Adult immunisationAdult immunisation
Adult immunisation
 
DR JRK ADULT IMMUNIZATION programme.pptx
DR JRK ADULT IMMUNIZATION programme.pptxDR JRK ADULT IMMUNIZATION programme.pptx
DR JRK ADULT IMMUNIZATION programme.pptx
 
Human vaccinations ppt by dr. hussein abass
Human vaccinations  ppt by dr. hussein abassHuman vaccinations  ppt by dr. hussein abass
Human vaccinations ppt by dr. hussein abass
 
‎Untitled.pptx
‎Untitled.pptx‎Untitled.pptx
‎Untitled.pptx
 
Vaccination of healthcare workers, Dr. V. Anil Kumar
Vaccination of healthcare workers, Dr. V. Anil KumarVaccination of healthcare workers, Dr. V. Anil Kumar
Vaccination of healthcare workers, Dr. V. Anil Kumar
 
VACCINOLOGY.pptx
VACCINOLOGY.pptxVACCINOLOGY.pptx
VACCINOLOGY.pptx
 
Vaccination of pregnant women and health care workers - Slideset by Professor...
Vaccination of pregnant women and health care workers - Slideset by Professor...Vaccination of pregnant women and health care workers - Slideset by Professor...
Vaccination of pregnant women and health care workers - Slideset by Professor...
 
Human vaccinations in egypt 2021
Human vaccinations in egypt   2021Human vaccinations in egypt   2021
Human vaccinations in egypt 2021
 
Immunization in adults, geriatrics and paediatrics.
Immunization in adults, geriatrics and paediatrics.Immunization in adults, geriatrics and paediatrics.
Immunization in adults, geriatrics and paediatrics.
 
Chicken pox vaccine presentation jalandhar july 2017
Chicken pox vaccine presentation jalandhar july 2017Chicken pox vaccine presentation jalandhar july 2017
Chicken pox vaccine presentation jalandhar july 2017
 
LATEST IAP GUIDELINES OF IMMUNISATION
LATEST IAP GUIDELINES OF IMMUNISATION LATEST IAP GUIDELINES OF IMMUNISATION
LATEST IAP GUIDELINES OF IMMUNISATION
 
Bacterialvaccine (1).ppt
Bacterialvaccine (1).pptBacterialvaccine (1).ppt
Bacterialvaccine (1).ppt
 
Adult combined-schedule-bw
Adult combined-schedule-bwAdult combined-schedule-bw
Adult combined-schedule-bw
 
Immunization programme
Immunization programmeImmunization programme
Immunization programme
 
NEWER VACCINE PPT.ppt
NEWER VACCINE PPT.pptNEWER VACCINE PPT.ppt
NEWER VACCINE PPT.ppt
 
finalnewervaccinesakhileshppt-210521062533(3)(1).pptx
finalnewervaccinesakhileshppt-210521062533(3)(1).pptxfinalnewervaccinesakhileshppt-210521062533(3)(1).pptx
finalnewervaccinesakhileshppt-210521062533(3)(1).pptx
 
Immunisations and kidney transplantation
Immunisations and kidney transplantationImmunisations and kidney transplantation
Immunisations and kidney transplantation
 
Adult schedule-bw
Adult schedule-bwAdult schedule-bw
Adult schedule-bw
 
Immunisation programme.pptx
Immunisation programme.pptxImmunisation programme.pptx
Immunisation programme.pptx
 
VACCINATION.pptx
VACCINATION.pptxVACCINATION.pptx
VACCINATION.pptx
 

Plus de DrTapasTripathi

IgG4-Related Disease - Lam.pptx
IgG4-Related Disease - Lam.pptxIgG4-Related Disease - Lam.pptx
IgG4-Related Disease - Lam.pptxDrTapasTripathi
 
thyroid hypothyroidism.pptx
thyroid hypothyroidism.pptxthyroid hypothyroidism.pptx
thyroid hypothyroidism.pptxDrTapasTripathi
 
Rivaroxaban, a New Molecule with Potential toABHISHEK.pptx
Rivaroxaban, a New Molecule with Potential toABHISHEK.pptxRivaroxaban, a New Molecule with Potential toABHISHEK.pptx
Rivaroxaban, a New Molecule with Potential toABHISHEK.pptxDrTapasTripathi
 
Acute Kidney Injury in fever.pptx
Acute Kidney Injury in fever.pptxAcute Kidney Injury in fever.pptx
Acute Kidney Injury in fever.pptxDrTapasTripathi
 
Predictors of Outcome in Acute Respiratory Distress Syndrome with Acute febri...
Predictors of Outcome in Acute Respiratory Distress Syndrome with Acute febri...Predictors of Outcome in Acute Respiratory Distress Syndrome with Acute febri...
Predictors of Outcome in Acute Respiratory Distress Syndrome with Acute febri...DrTapasTripathi
 
pulmonaryfunctiontest-171120183455.pdf
pulmonaryfunctiontest-171120183455.pdfpulmonaryfunctiontest-171120183455.pdf
pulmonaryfunctiontest-171120183455.pdfDrTapasTripathi
 
Predictors of prolonged hospital stay in patients with Acute pulmonary thromb...
Predictors of prolonged hospital stay in patients with Acute pulmonary thromb...Predictors of prolonged hospital stay in patients with Acute pulmonary thromb...
Predictors of prolonged hospital stay in patients with Acute pulmonary thromb...DrTapasTripathi
 

Plus de DrTapasTripathi (11)

IgG4-Related Disease - Lam.pptx
IgG4-Related Disease - Lam.pptxIgG4-Related Disease - Lam.pptx
IgG4-Related Disease - Lam.pptx
 
thyroid hypothyroidism.pptx
thyroid hypothyroidism.pptxthyroid hypothyroidism.pptx
thyroid hypothyroidism.pptx
 
Rivaroxaban, a New Molecule with Potential toABHISHEK.pptx
Rivaroxaban, a New Molecule with Potential toABHISHEK.pptxRivaroxaban, a New Molecule with Potential toABHISHEK.pptx
Rivaroxaban, a New Molecule with Potential toABHISHEK.pptx
 
Parkinsonism
Parkinsonism Parkinsonism
Parkinsonism
 
Acute Kidney Injury in fever.pptx
Acute Kidney Injury in fever.pptxAcute Kidney Injury in fever.pptx
Acute Kidney Injury in fever.pptx
 
Predictors of Outcome in Acute Respiratory Distress Syndrome with Acute febri...
Predictors of Outcome in Acute Respiratory Distress Syndrome with Acute febri...Predictors of Outcome in Acute Respiratory Distress Syndrome with Acute febri...
Predictors of Outcome in Acute Respiratory Distress Syndrome with Acute febri...
 
Pulmonary function test
Pulmonary function testPulmonary function test
Pulmonary function test
 
pulmonaryfunctiontest-171120183455.pdf
pulmonaryfunctiontest-171120183455.pdfpulmonaryfunctiontest-171120183455.pdf
pulmonaryfunctiontest-171120183455.pdf
 
PFT
PFT PFT
PFT
 
Pft
PftPft
Pft
 
Predictors of prolonged hospital stay in patients with Acute pulmonary thromb...
Predictors of prolonged hospital stay in patients with Acute pulmonary thromb...Predictors of prolonged hospital stay in patients with Acute pulmonary thromb...
Predictors of prolonged hospital stay in patients with Acute pulmonary thromb...
 

Dernier

Glomerular Filtration and determinants of glomerular filtration .pptx
Glomerular Filtration and  determinants of glomerular filtration .pptxGlomerular Filtration and  determinants of glomerular filtration .pptx
Glomerular Filtration and determinants of glomerular filtration .pptxDr.Nusrat Tariq
 
Call Girls Jp Nagar Just Call 7001305949 Top Class Call Girl Service Available
Call Girls Jp Nagar Just Call 7001305949 Top Class Call Girl Service AvailableCall Girls Jp Nagar Just Call 7001305949 Top Class Call Girl Service Available
Call Girls Jp Nagar Just Call 7001305949 Top Class Call Girl Service Availablenarwatsonia7
 
Call Girls Kanakapura Road Just Call 7001305949 Top Class Call Girl Service A...
Call Girls Kanakapura Road Just Call 7001305949 Top Class Call Girl Service A...Call Girls Kanakapura Road Just Call 7001305949 Top Class Call Girl Service A...
Call Girls Kanakapura Road Just Call 7001305949 Top Class Call Girl Service A...narwatsonia7
 
Call Girls Service In Shyam Nagar Whatsapp 8445551418 Independent Escort Service
Call Girls Service In Shyam Nagar Whatsapp 8445551418 Independent Escort ServiceCall Girls Service In Shyam Nagar Whatsapp 8445551418 Independent Escort Service
Call Girls Service In Shyam Nagar Whatsapp 8445551418 Independent Escort Serviceparulsinha
 
College Call Girls Vyasarpadi Whatsapp 7001305949 Independent Escort Service
College Call Girls Vyasarpadi Whatsapp 7001305949 Independent Escort ServiceCollege Call Girls Vyasarpadi Whatsapp 7001305949 Independent Escort Service
College Call Girls Vyasarpadi Whatsapp 7001305949 Independent Escort ServiceNehru place Escorts
 
Book Call Girls in Yelahanka - For 7001305949 Cheap & Best with original Photos
Book Call Girls in Yelahanka - For 7001305949 Cheap & Best with original PhotosBook Call Girls in Yelahanka - For 7001305949 Cheap & Best with original Photos
Book Call Girls in Yelahanka - For 7001305949 Cheap & Best with original Photosnarwatsonia7
 
Russian Call Girl Brookfield - 7001305949 Escorts Service 50% Off with Cash O...
Russian Call Girl Brookfield - 7001305949 Escorts Service 50% Off with Cash O...Russian Call Girl Brookfield - 7001305949 Escorts Service 50% Off with Cash O...
Russian Call Girl Brookfield - 7001305949 Escorts Service 50% Off with Cash O...narwatsonia7
 
Low Rate Call Girls Pune Esha 9907093804 Short 1500 Night 6000 Best call girl...
Low Rate Call Girls Pune Esha 9907093804 Short 1500 Night 6000 Best call girl...Low Rate Call Girls Pune Esha 9907093804 Short 1500 Night 6000 Best call girl...
Low Rate Call Girls Pune Esha 9907093804 Short 1500 Night 6000 Best call girl...Miss joya
 
High Profile Call Girls Jaipur Vani 8445551418 Independent Escort Service Jaipur
High Profile Call Girls Jaipur Vani 8445551418 Independent Escort Service JaipurHigh Profile Call Girls Jaipur Vani 8445551418 Independent Escort Service Jaipur
High Profile Call Girls Jaipur Vani 8445551418 Independent Escort Service Jaipurparulsinha
 
Call Girls Hosur Just Call 7001305949 Top Class Call Girl Service Available
Call Girls Hosur Just Call 7001305949 Top Class Call Girl Service AvailableCall Girls Hosur Just Call 7001305949 Top Class Call Girl Service Available
Call Girls Hosur Just Call 7001305949 Top Class Call Girl Service Availablenarwatsonia7
 
Call Girls Jayanagar Just Call 7001305949 Top Class Call Girl Service Available
Call Girls Jayanagar Just Call 7001305949 Top Class Call Girl Service AvailableCall Girls Jayanagar Just Call 7001305949 Top Class Call Girl Service Available
Call Girls Jayanagar Just Call 7001305949 Top Class Call Girl Service Availablenarwatsonia7
 
Call Girls Hebbal Just Call 7001305949 Top Class Call Girl Service Available
Call Girls Hebbal Just Call 7001305949 Top Class Call Girl Service AvailableCall Girls Hebbal Just Call 7001305949 Top Class Call Girl Service Available
Call Girls Hebbal Just Call 7001305949 Top Class Call Girl Service Availablenarwatsonia7
 
Housewife Call Girls Bangalore - Call 7001305949 Rs-3500 with A/C Room Cash o...
Housewife Call Girls Bangalore - Call 7001305949 Rs-3500 with A/C Room Cash o...Housewife Call Girls Bangalore - Call 7001305949 Rs-3500 with A/C Room Cash o...
Housewife Call Girls Bangalore - Call 7001305949 Rs-3500 with A/C Room Cash o...narwatsonia7
 
VIP Call Girls Lucknow Nandini 7001305949 Independent Escort Service Lucknow
VIP Call Girls Lucknow Nandini 7001305949 Independent Escort Service LucknowVIP Call Girls Lucknow Nandini 7001305949 Independent Escort Service Lucknow
VIP Call Girls Lucknow Nandini 7001305949 Independent Escort Service Lucknownarwatsonia7
 
Call Girl Koramangala | 7001305949 At Low Cost Cash Payment Booking
Call Girl Koramangala | 7001305949 At Low Cost Cash Payment BookingCall Girl Koramangala | 7001305949 At Low Cost Cash Payment Booking
Call Girl Koramangala | 7001305949 At Low Cost Cash Payment Bookingnarwatsonia7
 
College Call Girls Pune Mira 9907093804 Short 1500 Night 6000 Best call girls...
College Call Girls Pune Mira 9907093804 Short 1500 Night 6000 Best call girls...College Call Girls Pune Mira 9907093804 Short 1500 Night 6000 Best call girls...
College Call Girls Pune Mira 9907093804 Short 1500 Night 6000 Best call girls...Miss joya
 
Asthma Review - GINA guidelines summary 2024
Asthma Review - GINA guidelines summary 2024Asthma Review - GINA guidelines summary 2024
Asthma Review - GINA guidelines summary 2024Gabriel Guevara MD
 
call girls in green park DELHI 🔝 >༒9540349809 🔝 genuine Escort Service 🔝✔️✔️
call girls in green park  DELHI 🔝 >༒9540349809 🔝 genuine Escort Service 🔝✔️✔️call girls in green park  DELHI 🔝 >༒9540349809 🔝 genuine Escort Service 🔝✔️✔️
call girls in green park DELHI 🔝 >༒9540349809 🔝 genuine Escort Service 🔝✔️✔️saminamagar
 
Mumbai Call Girls Service 9910780858 Real Russian Girls Looking Models
Mumbai Call Girls Service 9910780858 Real Russian Girls Looking ModelsMumbai Call Girls Service 9910780858 Real Russian Girls Looking Models
Mumbai Call Girls Service 9910780858 Real Russian Girls Looking Modelssonalikaur4
 

Dernier (20)

Glomerular Filtration and determinants of glomerular filtration .pptx
Glomerular Filtration and  determinants of glomerular filtration .pptxGlomerular Filtration and  determinants of glomerular filtration .pptx
Glomerular Filtration and determinants of glomerular filtration .pptx
 
Call Girls Jp Nagar Just Call 7001305949 Top Class Call Girl Service Available
Call Girls Jp Nagar Just Call 7001305949 Top Class Call Girl Service AvailableCall Girls Jp Nagar Just Call 7001305949 Top Class Call Girl Service Available
Call Girls Jp Nagar Just Call 7001305949 Top Class Call Girl Service Available
 
Call Girls Kanakapura Road Just Call 7001305949 Top Class Call Girl Service A...
Call Girls Kanakapura Road Just Call 7001305949 Top Class Call Girl Service A...Call Girls Kanakapura Road Just Call 7001305949 Top Class Call Girl Service A...
Call Girls Kanakapura Road Just Call 7001305949 Top Class Call Girl Service A...
 
Call Girls Service In Shyam Nagar Whatsapp 8445551418 Independent Escort Service
Call Girls Service In Shyam Nagar Whatsapp 8445551418 Independent Escort ServiceCall Girls Service In Shyam Nagar Whatsapp 8445551418 Independent Escort Service
Call Girls Service In Shyam Nagar Whatsapp 8445551418 Independent Escort Service
 
College Call Girls Vyasarpadi Whatsapp 7001305949 Independent Escort Service
College Call Girls Vyasarpadi Whatsapp 7001305949 Independent Escort ServiceCollege Call Girls Vyasarpadi Whatsapp 7001305949 Independent Escort Service
College Call Girls Vyasarpadi Whatsapp 7001305949 Independent Escort Service
 
Book Call Girls in Yelahanka - For 7001305949 Cheap & Best with original Photos
Book Call Girls in Yelahanka - For 7001305949 Cheap & Best with original PhotosBook Call Girls in Yelahanka - For 7001305949 Cheap & Best with original Photos
Book Call Girls in Yelahanka - For 7001305949 Cheap & Best with original Photos
 
Russian Call Girl Brookfield - 7001305949 Escorts Service 50% Off with Cash O...
Russian Call Girl Brookfield - 7001305949 Escorts Service 50% Off with Cash O...Russian Call Girl Brookfield - 7001305949 Escorts Service 50% Off with Cash O...
Russian Call Girl Brookfield - 7001305949 Escorts Service 50% Off with Cash O...
 
Low Rate Call Girls Pune Esha 9907093804 Short 1500 Night 6000 Best call girl...
Low Rate Call Girls Pune Esha 9907093804 Short 1500 Night 6000 Best call girl...Low Rate Call Girls Pune Esha 9907093804 Short 1500 Night 6000 Best call girl...
Low Rate Call Girls Pune Esha 9907093804 Short 1500 Night 6000 Best call girl...
 
High Profile Call Girls Jaipur Vani 8445551418 Independent Escort Service Jaipur
High Profile Call Girls Jaipur Vani 8445551418 Independent Escort Service JaipurHigh Profile Call Girls Jaipur Vani 8445551418 Independent Escort Service Jaipur
High Profile Call Girls Jaipur Vani 8445551418 Independent Escort Service Jaipur
 
Call Girls Hosur Just Call 7001305949 Top Class Call Girl Service Available
Call Girls Hosur Just Call 7001305949 Top Class Call Girl Service AvailableCall Girls Hosur Just Call 7001305949 Top Class Call Girl Service Available
Call Girls Hosur Just Call 7001305949 Top Class Call Girl Service Available
 
Call Girls Jayanagar Just Call 7001305949 Top Class Call Girl Service Available
Call Girls Jayanagar Just Call 7001305949 Top Class Call Girl Service AvailableCall Girls Jayanagar Just Call 7001305949 Top Class Call Girl Service Available
Call Girls Jayanagar Just Call 7001305949 Top Class Call Girl Service Available
 
Call Girls Hebbal Just Call 7001305949 Top Class Call Girl Service Available
Call Girls Hebbal Just Call 7001305949 Top Class Call Girl Service AvailableCall Girls Hebbal Just Call 7001305949 Top Class Call Girl Service Available
Call Girls Hebbal Just Call 7001305949 Top Class Call Girl Service Available
 
Housewife Call Girls Bangalore - Call 7001305949 Rs-3500 with A/C Room Cash o...
Housewife Call Girls Bangalore - Call 7001305949 Rs-3500 with A/C Room Cash o...Housewife Call Girls Bangalore - Call 7001305949 Rs-3500 with A/C Room Cash o...
Housewife Call Girls Bangalore - Call 7001305949 Rs-3500 with A/C Room Cash o...
 
VIP Call Girls Lucknow Nandini 7001305949 Independent Escort Service Lucknow
VIP Call Girls Lucknow Nandini 7001305949 Independent Escort Service LucknowVIP Call Girls Lucknow Nandini 7001305949 Independent Escort Service Lucknow
VIP Call Girls Lucknow Nandini 7001305949 Independent Escort Service Lucknow
 
Call Girl Koramangala | 7001305949 At Low Cost Cash Payment Booking
Call Girl Koramangala | 7001305949 At Low Cost Cash Payment BookingCall Girl Koramangala | 7001305949 At Low Cost Cash Payment Booking
Call Girl Koramangala | 7001305949 At Low Cost Cash Payment Booking
 
sauth delhi call girls in Bhajanpura 🔝 9953056974 🔝 escort Service
sauth delhi call girls in Bhajanpura 🔝 9953056974 🔝 escort Servicesauth delhi call girls in Bhajanpura 🔝 9953056974 🔝 escort Service
sauth delhi call girls in Bhajanpura 🔝 9953056974 🔝 escort Service
 
College Call Girls Pune Mira 9907093804 Short 1500 Night 6000 Best call girls...
College Call Girls Pune Mira 9907093804 Short 1500 Night 6000 Best call girls...College Call Girls Pune Mira 9907093804 Short 1500 Night 6000 Best call girls...
College Call Girls Pune Mira 9907093804 Short 1500 Night 6000 Best call girls...
 
Asthma Review - GINA guidelines summary 2024
Asthma Review - GINA guidelines summary 2024Asthma Review - GINA guidelines summary 2024
Asthma Review - GINA guidelines summary 2024
 
call girls in green park DELHI 🔝 >༒9540349809 🔝 genuine Escort Service 🔝✔️✔️
call girls in green park  DELHI 🔝 >༒9540349809 🔝 genuine Escort Service 🔝✔️✔️call girls in green park  DELHI 🔝 >༒9540349809 🔝 genuine Escort Service 🔝✔️✔️
call girls in green park DELHI 🔝 >༒9540349809 🔝 genuine Escort Service 🔝✔️✔️
 
Mumbai Call Girls Service 9910780858 Real Russian Girls Looking Models
Mumbai Call Girls Service 9910780858 Real Russian Girls Looking ModelsMumbai Call Girls Service 9910780858 Real Russian Girls Looking Models
Mumbai Call Girls Service 9910780858 Real Russian Girls Looking Models
 

Immunization in adult

  • 1. Adult Immunization Dr Banu chander pandian. S DNB FAMILY MEDICINE KG HOSPITAL 6/23/2017 1
  • 2. Definition • Immunization refers to the artificial induction of immunity. It can be by Active Immunization: the use of live attenuated infectious agents or inactivated toxins, or antigens obtained by genetic recombination OR Passive Immunization: temporary immunity obtained by the administration of immunoglobulins or antitoxins. 6/23/2017 2
  • 4. • Smallpox eradicated in 1978 from India • polio eradication. • Infant/Childhood immunization – one of the top public health success stories of the 20th century • The prevalence of Diphtheria, Pertussis, tetanus, measles, mumps, rubella, poliomyelitis are reduced. 6/23/2017 4
  • 5. Why Adult Immunization ??? • Build on success of infant/childhood, adolescent immunization program. • Not vaccinated earlier, booster. • New vaccines targeted at adults. • Ageing : more susceptible. • Increasing Antimicrobial Resistance. • Recognition of the burden of adult vaccine- preventable disease. • No equivalent “Vaccines for Adults” program. 6/23/2017 5
  • 6. Adult Immunization recommended in india Tdap MMR Influenza Pneumococcal Hepatitis B Hepatitis A Varicella HPV (cervical cancer) Meningococcal Herpes Zoster 6/23/2017 6
  • 7. Diphtheria, Tetanus, Pertussis Vaccines • Two Tdap Vaccines are available for use in those who are more than 10 years of age. -Efficacy of Tdap vaccine - 92% Recommendations - for all adults who have not received Tdap or for whom vaccine status is not known 6/23/2017 7
  • 8. Measles, Mumps And Rubella Vaccines • In India the measles, mumps, rubella (MMR) live attenuated vaccine is manufactured using the following strains: • The measles and the rubella components are produced using human diploid cells while the mumps component is produced from chick embryo. • The MMR vaccine should be administered subcutaneously into the upper arm. 6/23/2017 8
  • 9. Indications • Adolesents and adults • Women of childbearing age who is not pregnant FREQUENCY • Two doses at interval of 4 weeks • Subcutaneously in upper arm
  • 10. Varicella (Chickenpox) 6/23/2017 10 Vaccines • Two Live attenuated VZV (Oka strain) vaccines for varicella virus are currently available in India. – Varilrix (GlaxoSmithKline, Belgium) and – Okavax (Pasteur Mérieux, France). Schedule - Interval between 2 doses should be 4– 8wks.
  • 11. Recommendations • All susceptible adults and adolescents should be vaccinated.(18-49yrs) • It is especially important to susceptible persons – Health care workers – Family contacts of immunocompromised persons – High risk of exposure (e.g., teachers, day care employees, military personnel, and international travelers). 6/23/2017 11
  • 12. Human Papilloma Virus • Papilloma virus infection is precursor to cervical cancer – Types 16, 18 account for 70% of cervical cancers Vaccines • Two types HPV vaccines are available. – Gardasil (Merck, USA), a quadrivalent vaccine containing HPV virus L1 protein like particles of HPV 6,11,16, and 18 – Cervarix (GlaxoSmithKline, Belgium) is a bivalent vaccine containing L1 VLPs of HPV 16,18. 6/23/2017 12
  • 13.
  • 14. Recommendations • The vaccine has to be delivered prior to exposure to the HPV virus. Therefore, the immunization must precede the sexual debut. • Age for initiation for vaccination to be 10 - 12 years. • Catch-up vaccination can be advised up to the age of 26 years for Gardasil vaccine and 45 years for Cervarix vaccine. 6/23/2017 14
  • 15. • Schedule – BHPV – 0,1,6 months – QHPV – 0,2,6 months For male HPV 4 is recommanded
  • 16. Hepatitis B Vaccines • For immunocompetent adults, 1ml (20 μg) of recombinant vaccine is administered at 0, 1, and 6 months as an intramuscular. • Protection (anti-HBs antibody titer of 10mIU/ml or higher) after recombinant vaccine – After first dose - 20% to 30% – After second dose - 75% to 80% – After third doses - 90% to 95% Recommendations • All unvaccinated adult risk for HBV infection and • All adults seeking protection from HBV infection including post-exposure prophylaxis. 6/23/2017 16
  • 17. • Booster doses of HBV vaccine are not indicated in persons with normal immune status . • For CKD patients, the need for booster doses should be assessed by annual anti- HBs antibody titre testing. • A booster dose should be administered when anti-HBs levels decline to less than 10 mIU/ml & <100 mIU/ml in patients on dialysis. . 6/23/2017 17
  • 19. Hepatitis A Vaccines • Inactivated-single antigen (HAV antigen) vaccines, – Havrix (GlaxoSmithKline) and – Vaqta (Merck & Co) – Dose : 1440ELU Schedule • Two doses of 1ml at 6 month interval. • Immune status for hepatitis A should be checked 6/23/2017 19
  • 20. Pneumococcal Infection Vaccines Two types • The pneumococcal polysaccharide vaccine (PPV23), contains 25 μg each of purified capsular polysaccharide from 23 serotypes of Streptococcus pneumoniae. • Pneumococcal conjugate vaccine (PCV 13) – This vaccine can be co-administered with live vaccines such as the influenza vaccine. 6/23/2017 20
  • 21. Schedule –A single standard dose (0.5 ml) is administered by the intramuscular or subcutaneous route. –Revaccination: 0.5ml IM or SC at least after 5 years of 1st dose in case of High risk people. 6/23/2017 21
  • 22. Influenza Vaccines – Trivalent inactivated influenza vaccine (TIV) and – Live attenuated influenza vaccine (LAIV) • The TIV contains – A/17/California/2009/38(H1N1), – A/Brisbane/ 10/2007 (H3N2), and – B/Brisbane/60/2008 strains. • Live attenuated influenza vaccine (LAIV) – Nasovac contains – A/17/California/2009/38 like strain • Schedule – The TIV - annual, single dose of 0.5 ml IM. – The LAIV – 0.5 ml intranasal (spray 0.25 ml per nostril) 6/23/2017 22
  • 23. Meningococcal Meningitis Vaccines • Types – Polysaccharide vaccines • Bivalent (A&C) • Quadrivalent (A,C,Y & W135) – Conjugate vaccines. • The vaccine does not induce herd immunity and has no effect on nasopharyngeal carriage. • Containing 50 μg of polysaccharide per dose. • After reconstitution use within 8-12 hours. 6/23/2017 23
  • 24. Schedule • A single dose of 0.5 ml SC in deltoid region. • Used in selected population • Age 2- 3 yrs • Congenital deficiencs in complement components • Travellers to hajj • Lab persons 6/23/2017 24
  • 25. Documentation • Provide copy of Vaccine Information Statement (VIS)to patient • Documents to be maintained – Date vaccination & next dose – Vaccine manufacturer – Lot number – Dose & site of vaccine 6/23/2017 25
  • 26. Vaccine Administration • Health care personnel should get proper training before administrating vaccine. • Always prepare and check the following for every vaccination you give: – Right Patient – Right Drug (vaccine) – Right Dose – Right Route (intramuscular, SC,intradermal) – Right Time (is scheduling correct) 6/23/2017 26
  • 27. Vaccine / Age group 19-26 yrs 27-49 yrs 50-59 yrs 60-64 yrs > 65 yrs Tetanus, Diptheria, Pertussis (Tdap) Substitude one time dose of Tdap with Td, then booster with Td every 10 years Td booster every 10 yrs Human Papiloma Vaccine 3 doses Varicella 2 doses Zoster 1 dose Measles, Mumps, Rubella 1 or 2 doses 1 dose Influenza 1 dose annually Pnemococcal (Polysaccharide) 1 or 2 doses 1 dose Hepatitis A 2 doses Hepatitis B 3 doses Meninngicoccal 1 or more doses 6/23/2017 27 ACIP Adult Immunization Schedule, Age-Based Recommendations, INDIA Recommended if some risk factor is present All persons who meet the age criteria No recommendation
  • 28. 6/23/2017 28 Adult Immunization based on medical and other indications (INDIA) Indications Pregnancy Immunoco mpromise d conditions (Excluding HIV) HIV infection with CD4 count Diabetes, heart disease, chronic lung disease Asplenia (excluding elective splenectomy ) Chronic liver disease Kidney failure, end stage renal disease, on hemodialysi s Health care professi onals Vaccine <200 cells/ µl >200 cells/ µl Tetanus, Diptheria, Pertussis (Tdap) Td Substitute one time dose of Tdap with Td, then booster with Td every 10 years Human Pappiloma Vaccine 3 doses for females through age 26 years Varicella Contraindication 2 doses Zoster Contraindication 1 dose Measles, Mumps, Rubella Contraindication 1 or 2 doses Influenza 1 dose TIV annually 1 dose TIV or LAIV Pnemococcal (Polysaccharide) 1 or 2 doses Hepatitis A 2 doses Hepatitis B 3 doses Meninngicoccal 1 or more doses Recommended if some risk factor is present All persons who meet the age criteria Contraindication