SlideShare une entreprise Scribd logo
1  sur  17
• Vision for livestock genetics in Africa
• Steve Kemp, ILRI
Animal Genetic Research for Africa (Biosciences for Farming in
Africa), Nairobi, 10-11 September 2015
Genetic selection, interacting with
environment, drives
‘improvement’
-1000
0
1000
2000
3000
4000
5000
6000
7000
1950 1960 1970 1980 1990 2000 2010
Year
Changeinmilkyield(kg)
(Source:
http://aipl.arsusda.gov/eval/summary/trend.cfm)
Changes in milk yields of US Holstein cows
Mean phenotype (P), breeding value (A) and environmental effects (E = A - P).
Results relative to 1957 base (mean yield 5859kg).
A
P
E
In the industrial world
genetics has driven
dramatic improvements in
productivity
• Homogeneous
environments (systems,
markets, health,
regulations, policies…….)
• Homogeneous genetics (a
handful of well defined
breeds)
• Superb data recording
driving selection schemes
Achieving genetic gain in developing countries – the
same biological rules but different environments
We must take account of the
realities of small-scale
livestock producers.
Diversity of:
• Environment
• Climate
• Feeds available
• Endemic diseases
• Local market context
• Infrastructure
• Institutions
Achieving genetic gain in developing countries – the
same biological rules but different environments
We must take account of the
realities of small-scale
livestock producers.
Diversity of:
• Environment
• Climate
• Feeds available
• Endemic diseases
• Local market context
• Infrastructure
• Institutions
No data systems to
inform selection.
No infrastructure to
manage selection.
Genotype data is cheap and easy to obtain.
Phenotype data remains a problem.
Can we skip a generation of
technology?
• Fast, light, cheap
performance data
harvesting.
• Cheap sensors, mobile
platforms, crowd sensing…..
• Simultaneously providing
management information to
the farmer and
performance data to the
breeder.
Diversity of environments has created diversity of
genetics. Let’s not discard it.
African Trypanosomiasis
• Caused by extracellular protozoan parasites –
Trypanosoma
• Transmitted between mammals by Tsetse
flies (Glossina sp.)
• Prevalent in 36 countries of sub-Sahara Africa.
In cattle
• A chronic debilitating and fatal disease.
• A major constraint on livestock and
agricultural production in Africa.
• Costs US$ 1 billion annually.
In human (Human Sleeping Sickness)
• Fatal
• 60,000 people die every year
• Both wild and domestic animals are the major
reservoir of the parasites for human infection.
African Trypanosomiasis
Control and Treatment options for African Trypanosomiasis
Vector Control (Tsetse Fly)
• Using toxic insecticide
• Not sustainable
• Negative impacts on environment
Vaccine
• Tryps periodically change the major surface antigen – variant
surface glycoprotein (VSG) and evade the host immune system.
• More than 2 decades, there is no effective vaccine developed.
Drug
• Drug toxicity and resistance
• Expensive
New tools allow us to look in new places for
sources of variation – including wildlife
Comparative gene network
and sequence analysis allows
to ask new kinds of questions
about genomes – eg “what is
different about this (group of)
species compared to all other
mammals”
“traditional” linkage mapping requires crosses – so initial discovery is
limited to variants within a species
Cow NDama KFITRRPSLKTLQEKGLIKDQIFGSPLHTLCEREKSTVPRFVKQCIEAVEK
Cow Boran KFITRRPSLKTLQEKGLIKDQIFGSHLHTLCEREKSTVPRFVKQCIEAVEK
Human KFISRRPSLKTLQEKGLIKDQIFGSHLHTVCEREHSTVPWFVKQCIEAVEK
Pig KFITRRPSLKTLQEKGLIKDQIFGSHLHTVCERENSTVPRFVKQCIEAVEK
Chicken KFISRRPSLKTLQEKGLIKDQIFGSHLHLVCEHENSTVPQFVRQCIKAVER
Salmon KFISRRPSMKTLQEKGIIKDRVFGCHLLALCEREGTTVPKFVRQCVEAVEK
Time for a new search for variation underlying
tropical adaptation and productivity
Identify and make use of the
genetics underlying natural
variation.
There has been no systematic
search for the genomic basis of
adaptation. Because until now
we have had no validation
tools and no delivery tools.
New Genome Editing tools
change the landscape.
Identify and deliver variants associated with adaptation
GenotypingPhenotyping
Adapted &
productive
livestock
Genome
editing
Targeting
Data systems
Delivery
systems
TLF
ApoL-I
• Apolipoprotein
• Trypanolytic component
Hpr
• Haptoglobin-related
protein
• Facilitates the uptake of TLF
by trypanosomes via
haptoglobin-hemoglobin
receptor.
ApoL-I released
Activated in acidic
lysosome
Form membrane
pores, resulting in
ion disregulation
and osmotic
imbalance
Trypanosomes lysis
Endocytosed into
lysosome by
Trypanosomes
ApoA-I
• Apolipoprotein
• Found in all HDL subclasses
Killing of Tryps by Trypanosome Lytic Factor (TLF)
Flagellar pocket of Tryp
Complete protection from Trypanosomes by baboon
ApoL-I in transiently transgenic mice
0 20 40 60 80 100 120 140
0
20
40
60
80
100
Vector (N=6)
apoL-I + Hpr (N=5)
apoL-I (N=5)
*
*
Days post infection
• P = < 0.01
• Vector vs. treatment
Thomson et al PNAS 2009 106:19509-19514
Project Strategy
Genomic locus of
Baboon apoL-I gene
Vector construction
Validate the construct in
transgenic mouse
Bovine embryonic fibroblasts
(BEF) primary culture
Transfection & screening
apoL-I Transgenic BEFs
Nuclear Transfer
Transgenic calves
Phenotyping
Trypanosome resistant
transgenic Boran bull
ILRI
ILRI
Kenya
Boran
Roslin
Institute
New York
University
Michigan
State
University
Tumaini
A cloned Kenya Boran calf
made by SCNT from a Boran
embryo fibroblast cell line
20
The presentation has a Creative Commons licence. You are free to re-use or distribute this work, provided credit is given to ILRI.
better lives through livestock
ilri.org
http://vimeo.com/74942619 11 minute version
Video ‘Developing disease-resistant cattle for Africa’
http://vimeo.com/74940697 3 minute version

Contenu connexe

Tendances

Livestock and food security: An ILRI perspective
Livestock and food security: An ILRI perspectiveLivestock and food security: An ILRI perspective
Livestock and food security: An ILRI perspectiveILRI
 
The role of informal food markets—Towards professionalizing, not criminalizing
The role of informal food markets—Towards professionalizing, not criminalizingThe role of informal food markets—Towards professionalizing, not criminalizing
The role of informal food markets—Towards professionalizing, not criminalizingILRI
 
Better lives through livestock
Better lives through livestockBetter lives through livestock
Better lives through livestockILRI
 
Feeding research and feeding innovation
Feeding research and feeding innovationFeeding research and feeding innovation
Feeding research and feeding innovationILRI
 
The livestock landscape and ILRI in Southern Africa
The livestock landscape and ILRI in Southern AfricaThe livestock landscape and ILRI in Southern Africa
The livestock landscape and ILRI in Southern AfricaILRI
 
Towards successful, and sustainable, livestock futures worldwide
Towards successful, and sustainable, livestock futures worldwideTowards successful, and sustainable, livestock futures worldwide
Towards successful, and sustainable, livestock futures worldwideILRI
 
The opportunities and challenges for livestock and aquaculture research for d...
The opportunities and challenges for livestock and aquaculture research for d...The opportunities and challenges for livestock and aquaculture research for d...
The opportunities and challenges for livestock and aquaculture research for d...GCARD Conferences
 
Gender Responsive Research
Gender Responsive ResearchGender Responsive Research
Gender Responsive ResearchCIAT
 
The global livestock sector: Trends, drivers and implications for society, he...
The global livestock sector: Trends, drivers and implications for society, he...The global livestock sector: Trends, drivers and implications for society, he...
The global livestock sector: Trends, drivers and implications for society, he...ILRI
 
Antimicrobial use in developing countries
Antimicrobial use in developing countriesAntimicrobial use in developing countries
Antimicrobial use in developing countriesILRI
 
The role of livestock in achieving the SDGs
  The role of livestock in achieving the SDGs  The role of livestock in achieving the SDGs
The role of livestock in achieving the SDGsILRI
 
Innovative processing of cassava peels to livestock feeds—A collaborative pro...
Innovative processing of cassava peels to livestock feeds—A collaborative pro...Innovative processing of cassava peels to livestock feeds—A collaborative pro...
Innovative processing of cassava peels to livestock feeds—A collaborative pro...ILRI
 
Antimicrobial resistance and the global livestock sector
Antimicrobial resistance and the global livestock sectorAntimicrobial resistance and the global livestock sector
Antimicrobial resistance and the global livestock sectorILRI
 
Raising the visibility of livestock in African Policy Dialogue
Raising the visibility of livestock in African Policy DialogueRaising the visibility of livestock in African Policy Dialogue
Raising the visibility of livestock in African Policy DialogueILRI
 
Livestock in the horn of Africa: An opportunity in waiting
Livestock in the horn of Africa: An opportunity in waiting Livestock in the horn of Africa: An opportunity in waiting
Livestock in the horn of Africa: An opportunity in waiting ILRI
 
Food safety and informal markets: Animal products in sub-Saharan Africa
Food safety and informal markets: Animal products in sub-Saharan AfricaFood safety and informal markets: Animal products in sub-Saharan Africa
Food safety and informal markets: Animal products in sub-Saharan AfricaILRI
 
The emerging middle class and the world market for beef
The emerging middle class and  the world market for beefThe emerging middle class and  the world market for beef
The emerging middle class and the world market for beefILRI
 
Studies of zoonoses in dynamic livestock systems in Kenya
Studies of zoonoses in dynamic livestock systems in KenyaStudies of zoonoses in dynamic livestock systems in Kenya
Studies of zoonoses in dynamic livestock systems in KenyaILRI
 
Livestock, livelihoods and the future of India’s smallholder farmers
Livestock, livelihoods and the future of India’s smallholder farmersLivestock, livelihoods and the future of India’s smallholder farmers
Livestock, livelihoods and the future of India’s smallholder farmersILRI
 

Tendances (20)

Livestock and food security: An ILRI perspective
Livestock and food security: An ILRI perspectiveLivestock and food security: An ILRI perspective
Livestock and food security: An ILRI perspective
 
The role of informal food markets—Towards professionalizing, not criminalizing
The role of informal food markets—Towards professionalizing, not criminalizingThe role of informal food markets—Towards professionalizing, not criminalizing
The role of informal food markets—Towards professionalizing, not criminalizing
 
Better lives through livestock
Better lives through livestockBetter lives through livestock
Better lives through livestock
 
CRP portfolio 2017-2022 - Wayne Powell
CRP portfolio 2017-2022 - Wayne PowellCRP portfolio 2017-2022 - Wayne Powell
CRP portfolio 2017-2022 - Wayne Powell
 
Feeding research and feeding innovation
Feeding research and feeding innovationFeeding research and feeding innovation
Feeding research and feeding innovation
 
The livestock landscape and ILRI in Southern Africa
The livestock landscape and ILRI in Southern AfricaThe livestock landscape and ILRI in Southern Africa
The livestock landscape and ILRI in Southern Africa
 
Towards successful, and sustainable, livestock futures worldwide
Towards successful, and sustainable, livestock futures worldwideTowards successful, and sustainable, livestock futures worldwide
Towards successful, and sustainable, livestock futures worldwide
 
The opportunities and challenges for livestock and aquaculture research for d...
The opportunities and challenges for livestock and aquaculture research for d...The opportunities and challenges for livestock and aquaculture research for d...
The opportunities and challenges for livestock and aquaculture research for d...
 
Gender Responsive Research
Gender Responsive ResearchGender Responsive Research
Gender Responsive Research
 
The global livestock sector: Trends, drivers and implications for society, he...
The global livestock sector: Trends, drivers and implications for society, he...The global livestock sector: Trends, drivers and implications for society, he...
The global livestock sector: Trends, drivers and implications for society, he...
 
Antimicrobial use in developing countries
Antimicrobial use in developing countriesAntimicrobial use in developing countries
Antimicrobial use in developing countries
 
The role of livestock in achieving the SDGs
  The role of livestock in achieving the SDGs  The role of livestock in achieving the SDGs
The role of livestock in achieving the SDGs
 
Innovative processing of cassava peels to livestock feeds—A collaborative pro...
Innovative processing of cassava peels to livestock feeds—A collaborative pro...Innovative processing of cassava peels to livestock feeds—A collaborative pro...
Innovative processing of cassava peels to livestock feeds—A collaborative pro...
 
Antimicrobial resistance and the global livestock sector
Antimicrobial resistance and the global livestock sectorAntimicrobial resistance and the global livestock sector
Antimicrobial resistance and the global livestock sector
 
Raising the visibility of livestock in African Policy Dialogue
Raising the visibility of livestock in African Policy DialogueRaising the visibility of livestock in African Policy Dialogue
Raising the visibility of livestock in African Policy Dialogue
 
Livestock in the horn of Africa: An opportunity in waiting
Livestock in the horn of Africa: An opportunity in waiting Livestock in the horn of Africa: An opportunity in waiting
Livestock in the horn of Africa: An opportunity in waiting
 
Food safety and informal markets: Animal products in sub-Saharan Africa
Food safety and informal markets: Animal products in sub-Saharan AfricaFood safety and informal markets: Animal products in sub-Saharan Africa
Food safety and informal markets: Animal products in sub-Saharan Africa
 
The emerging middle class and the world market for beef
The emerging middle class and  the world market for beefThe emerging middle class and  the world market for beef
The emerging middle class and the world market for beef
 
Studies of zoonoses in dynamic livestock systems in Kenya
Studies of zoonoses in dynamic livestock systems in KenyaStudies of zoonoses in dynamic livestock systems in Kenya
Studies of zoonoses in dynamic livestock systems in Kenya
 
Livestock, livelihoods and the future of India’s smallholder farmers
Livestock, livelihoods and the future of India’s smallholder farmersLivestock, livelihoods and the future of India’s smallholder farmers
Livestock, livelihoods and the future of India’s smallholder farmers
 

En vedette

Healthy people, animals and ecosystems: The role of CGIAR research
Healthy people, animals and ecosystems: The role of CGIAR researchHealthy people, animals and ecosystems: The role of CGIAR research
Healthy people, animals and ecosystems: The role of CGIAR researchILRI
 
Serological evidence of MERS-CoV antibodies in dromedary camels (Camelus drom...
Serological evidence of MERS-CoV antibodies in dromedary camels (Camelus drom...Serological evidence of MERS-CoV antibodies in dromedary camels (Camelus drom...
Serological evidence of MERS-CoV antibodies in dromedary camels (Camelus drom...ILRI
 
Overview of Capacity Development at ILRI
Overview of Capacity Development at ILRIOverview of Capacity Development at ILRI
Overview of Capacity Development at ILRIILRI
 
The road to CGSpace
The road to CGSpaceThe road to CGSpace
The road to CGSpaceILRI
 
Introducing some ILRI and CGIAR activities in Ethiopia
Introducing some ILRI and CGIAR activities in EthiopiaIntroducing some ILRI and CGIAR activities in Ethiopia
Introducing some ILRI and CGIAR activities in EthiopiaILRI
 
The livestock revolution and implications for human health and disease
The livestock revolution and implications for human health and diseaseThe livestock revolution and implications for human health and disease
The livestock revolution and implications for human health and diseaseILRI
 
BecA-ILRI Hub capacity building program: Empowering African scientists and in...
BecA-ILRI Hub capacity building program: Empowering African scientists and in...BecA-ILRI Hub capacity building program: Empowering African scientists and in...
BecA-ILRI Hub capacity building program: Empowering African scientists and in...ILRI
 
Resilience and sustainable development: Insights from the drylands of eastern...
Resilience and sustainable development: Insights from the drylands of eastern...Resilience and sustainable development: Insights from the drylands of eastern...
Resilience and sustainable development: Insights from the drylands of eastern...ILRI
 
Sustainable animal production systems in Africa
Sustainable animal production systems in AfricaSustainable animal production systems in Africa
Sustainable animal production systems in AfricaILRI
 
Livestock: The global context
Livestock: The global contextLivestock: The global context
Livestock: The global contextILRI
 
Why communicate animal genetics research
Why communicate  animal genetics research  Why communicate  animal genetics research
Why communicate animal genetics research ILRI
 
Sustainable livestock insurance for pastoralists: From research to practice a...
Sustainable livestock insurance for pastoralists: From research to practice a...Sustainable livestock insurance for pastoralists: From research to practice a...
Sustainable livestock insurance for pastoralists: From research to practice a...ILRI
 
Setting international livestock research priorities: Some livestock research ...
Setting international livestock research priorities: Some livestock research ...Setting international livestock research priorities: Some livestock research ...
Setting international livestock research priorities: Some livestock research ...ILRI
 
Using social media to communicate research: Experiences of the International ...
Using social media to communicate research: Experiences of the International ...Using social media to communicate research: Experiences of the International ...
Using social media to communicate research: Experiences of the International ...ILRI
 
CGIAR Research Program on Agriculture for Improved Nutrition and Health
CGIAR Research Program on Agriculture for Improved Nutrition and HealthCGIAR Research Program on Agriculture for Improved Nutrition and Health
CGIAR Research Program on Agriculture for Improved Nutrition and HealthILRI
 

En vedette (16)

Healthy people, animals and ecosystems: The role of CGIAR research
Healthy people, animals and ecosystems: The role of CGIAR researchHealthy people, animals and ecosystems: The role of CGIAR research
Healthy people, animals and ecosystems: The role of CGIAR research
 
Serological evidence of MERS-CoV antibodies in dromedary camels (Camelus drom...
Serological evidence of MERS-CoV antibodies in dromedary camels (Camelus drom...Serological evidence of MERS-CoV antibodies in dromedary camels (Camelus drom...
Serological evidence of MERS-CoV antibodies in dromedary camels (Camelus drom...
 
Overview of Capacity Development at ILRI
Overview of Capacity Development at ILRIOverview of Capacity Development at ILRI
Overview of Capacity Development at ILRI
 
The road to CGSpace
The road to CGSpaceThe road to CGSpace
The road to CGSpace
 
Introducing some ILRI and CGIAR activities in Ethiopia
Introducing some ILRI and CGIAR activities in EthiopiaIntroducing some ILRI and CGIAR activities in Ethiopia
Introducing some ILRI and CGIAR activities in Ethiopia
 
The livestock revolution and implications for human health and disease
The livestock revolution and implications for human health and diseaseThe livestock revolution and implications for human health and disease
The livestock revolution and implications for human health and disease
 
BecA-ILRI Hub capacity building program: Empowering African scientists and in...
BecA-ILRI Hub capacity building program: Empowering African scientists and in...BecA-ILRI Hub capacity building program: Empowering African scientists and in...
BecA-ILRI Hub capacity building program: Empowering African scientists and in...
 
CCAFS 4 Degree World by Philip Thornton
CCAFS 4 Degree World by Philip Thornton CCAFS 4 Degree World by Philip Thornton
CCAFS 4 Degree World by Philip Thornton
 
Resilience and sustainable development: Insights from the drylands of eastern...
Resilience and sustainable development: Insights from the drylands of eastern...Resilience and sustainable development: Insights from the drylands of eastern...
Resilience and sustainable development: Insights from the drylands of eastern...
 
Sustainable animal production systems in Africa
Sustainable animal production systems in AfricaSustainable animal production systems in Africa
Sustainable animal production systems in Africa
 
Livestock: The global context
Livestock: The global contextLivestock: The global context
Livestock: The global context
 
Why communicate animal genetics research
Why communicate  animal genetics research  Why communicate  animal genetics research
Why communicate animal genetics research
 
Sustainable livestock insurance for pastoralists: From research to practice a...
Sustainable livestock insurance for pastoralists: From research to practice a...Sustainable livestock insurance for pastoralists: From research to practice a...
Sustainable livestock insurance for pastoralists: From research to practice a...
 
Setting international livestock research priorities: Some livestock research ...
Setting international livestock research priorities: Some livestock research ...Setting international livestock research priorities: Some livestock research ...
Setting international livestock research priorities: Some livestock research ...
 
Using social media to communicate research: Experiences of the International ...
Using social media to communicate research: Experiences of the International ...Using social media to communicate research: Experiences of the International ...
Using social media to communicate research: Experiences of the International ...
 
CGIAR Research Program on Agriculture for Improved Nutrition and Health
CGIAR Research Program on Agriculture for Improved Nutrition and HealthCGIAR Research Program on Agriculture for Improved Nutrition and Health
CGIAR Research Program on Agriculture for Improved Nutrition and Health
 

Similaire à Vision for livestock genetics in Africa

Transgenic approach to improved productivity: Establishing African Trypanosom...
Transgenic approach to improved productivity: Establishing African Trypanosom...Transgenic approach to improved productivity: Establishing African Trypanosom...
Transgenic approach to improved productivity: Establishing African Trypanosom...ILRI
 
Biosciences research at the International Livestock Research Institute (ILRI)
Biosciences research at the International Livestock Research Institute (ILRI)Biosciences research at the International Livestock Research Institute (ILRI)
Biosciences research at the International Livestock Research Institute (ILRI)ILRI
 
Mzima Cow Project: A transgenics approach to the basic mechanisms underlying ...
Mzima Cow Project: A transgenics approach to the basic mechanisms underlying ...Mzima Cow Project: A transgenics approach to the basic mechanisms underlying ...
Mzima Cow Project: A transgenics approach to the basic mechanisms underlying ...ILRI
 
Research and innovation: key inputs for sustainable development
Research and innovation: key inputs for sustainable developmentResearch and innovation: key inputs for sustainable development
Research and innovation: key inputs for sustainable developmentSIANI
 
Population Structure & Genetic Improvement in Livestock
Population Structure & Genetic Improvement in LivestockPopulation Structure & Genetic Improvement in Livestock
Population Structure & Genetic Improvement in LivestockGolden Helix Inc
 
Monosex production of tilapia
Monosex production of tilapiaMonosex production of tilapia
Monosex production of tilapiaANJUSHA K V
 
African trypanosomiasis resistance in cattle by a transgenic approach
African trypanosomiasis resistance in cattle by a transgenic approachAfrican trypanosomiasis resistance in cattle by a transgenic approach
African trypanosomiasis resistance in cattle by a transgenic approachILRI
 
Dr Rajindar Saini, Principal Scientist and Head of Animal Health Division, ic...
Dr Rajindar Saini, Principal Scientist and Head of Animal Health Division, ic...Dr Rajindar Saini, Principal Scientist and Head of Animal Health Division, ic...
Dr Rajindar Saini, Principal Scientist and Head of Animal Health Division, ic...CatchTalk.TV
 
Research and Development Director, Tropical Agricultural Research and Higher ...
Research and Development Director, Tropical Agricultural Research and Higher ...Research and Development Director, Tropical Agricultural Research and Higher ...
Research and Development Director, Tropical Agricultural Research and Higher ...CatchTalk.TV
 
Genomics for African cattle challenges and opportunities: The East African sh...
Genomics for African cattle challenges and opportunities: The East African sh...Genomics for African cattle challenges and opportunities: The East African sh...
Genomics for African cattle challenges and opportunities: The East African sh...ILRI
 
Mycotoxins in livestock systems in developing countries
Mycotoxins in livestock systems in developing countriesMycotoxins in livestock systems in developing countries
Mycotoxins in livestock systems in developing countriesILRI
 
Aflatoxins and animal health: Case studies from Africa
Aflatoxins and animal health: Case studies from AfricaAflatoxins and animal health: Case studies from Africa
Aflatoxins and animal health: Case studies from AfricaILRI
 
Innovative use of conventional and new technologies to unravel breed options ...
Innovative use of conventional and new technologies to unravel breed options ...Innovative use of conventional and new technologies to unravel breed options ...
Innovative use of conventional and new technologies to unravel breed options ...ILRI
 
Genetics as a tool to improve flock health
Genetics as a tool to improve flock healthGenetics as a tool to improve flock health
Genetics as a tool to improve flock healthSusan Schoenian
 
Killer in the Kunai by Dr. David Williams
Killer in the Kunai by Dr. David WilliamsKiller in the Kunai by Dr. David Williams
Killer in the Kunai by Dr. David WilliamsBio-Ken
 
Aflatoxins, animal health and safety of animal source foods
Aflatoxins, animal health and safety of animal source foods Aflatoxins, animal health and safety of animal source foods
Aflatoxins, animal health and safety of animal source foods ILRI
 
Healthy animals equals healthy, productive people
Healthy animals equals healthy, productive peopleHealthy animals equals healthy, productive people
Healthy animals equals healthy, productive peopleILRI
 
Biodiversity, resource base, animal breed level characterization, and utility...
Biodiversity, resource base, animal breed level characterization, and utility...Biodiversity, resource base, animal breed level characterization, and utility...
Biodiversity, resource base, animal breed level characterization, and utility...ILRI
 
BioPharming (Molecular Farming)
BioPharming (Molecular Farming)BioPharming (Molecular Farming)
BioPharming (Molecular Farming)Kuldeep Sharma
 

Similaire à Vision for livestock genetics in Africa (20)

Transgenic approach to improved productivity: Establishing African Trypanosom...
Transgenic approach to improved productivity: Establishing African Trypanosom...Transgenic approach to improved productivity: Establishing African Trypanosom...
Transgenic approach to improved productivity: Establishing African Trypanosom...
 
Biosciences research at the International Livestock Research Institute (ILRI)
Biosciences research at the International Livestock Research Institute (ILRI)Biosciences research at the International Livestock Research Institute (ILRI)
Biosciences research at the International Livestock Research Institute (ILRI)
 
Mzima Cow Project: A transgenics approach to the basic mechanisms underlying ...
Mzima Cow Project: A transgenics approach to the basic mechanisms underlying ...Mzima Cow Project: A transgenics approach to the basic mechanisms underlying ...
Mzima Cow Project: A transgenics approach to the basic mechanisms underlying ...
 
Research and innovation: key inputs for sustainable development
Research and innovation: key inputs for sustainable developmentResearch and innovation: key inputs for sustainable development
Research and innovation: key inputs for sustainable development
 
Population Structure & Genetic Improvement in Livestock
Population Structure & Genetic Improvement in LivestockPopulation Structure & Genetic Improvement in Livestock
Population Structure & Genetic Improvement in Livestock
 
Monosex production of tilapia
Monosex production of tilapiaMonosex production of tilapia
Monosex production of tilapia
 
African trypanosomiasis resistance in cattle by a transgenic approach
African trypanosomiasis resistance in cattle by a transgenic approachAfrican trypanosomiasis resistance in cattle by a transgenic approach
African trypanosomiasis resistance in cattle by a transgenic approach
 
Dr Rajindar Saini, Principal Scientist and Head of Animal Health Division, ic...
Dr Rajindar Saini, Principal Scientist and Head of Animal Health Division, ic...Dr Rajindar Saini, Principal Scientist and Head of Animal Health Division, ic...
Dr Rajindar Saini, Principal Scientist and Head of Animal Health Division, ic...
 
Research and Development Director, Tropical Agricultural Research and Higher ...
Research and Development Director, Tropical Agricultural Research and Higher ...Research and Development Director, Tropical Agricultural Research and Higher ...
Research and Development Director, Tropical Agricultural Research and Higher ...
 
Genomics for African cattle challenges and opportunities: The East African sh...
Genomics for African cattle challenges and opportunities: The East African sh...Genomics for African cattle challenges and opportunities: The East African sh...
Genomics for African cattle challenges and opportunities: The East African sh...
 
Mycotoxins in livestock systems in developing countries
Mycotoxins in livestock systems in developing countriesMycotoxins in livestock systems in developing countries
Mycotoxins in livestock systems in developing countries
 
Aflatoxins and animal health: Case studies from Africa
Aflatoxins and animal health: Case studies from AfricaAflatoxins and animal health: Case studies from Africa
Aflatoxins and animal health: Case studies from Africa
 
Innovative use of conventional and new technologies to unravel breed options ...
Innovative use of conventional and new technologies to unravel breed options ...Innovative use of conventional and new technologies to unravel breed options ...
Innovative use of conventional and new technologies to unravel breed options ...
 
Genetics as a tool to improve flock health
Genetics as a tool to improve flock healthGenetics as a tool to improve flock health
Genetics as a tool to improve flock health
 
Killer in the Kunai by Dr. David Williams
Killer in the Kunai by Dr. David WilliamsKiller in the Kunai by Dr. David Williams
Killer in the Kunai by Dr. David Williams
 
Aflatoxins, animal health and safety of animal source foods
Aflatoxins, animal health and safety of animal source foods Aflatoxins, animal health and safety of animal source foods
Aflatoxins, animal health and safety of animal source foods
 
Gm wheat
Gm wheatGm wheat
Gm wheat
 
Healthy animals equals healthy, productive people
Healthy animals equals healthy, productive peopleHealthy animals equals healthy, productive people
Healthy animals equals healthy, productive people
 
Biodiversity, resource base, animal breed level characterization, and utility...
Biodiversity, resource base, animal breed level characterization, and utility...Biodiversity, resource base, animal breed level characterization, and utility...
Biodiversity, resource base, animal breed level characterization, and utility...
 
BioPharming (Molecular Farming)
BioPharming (Molecular Farming)BioPharming (Molecular Farming)
BioPharming (Molecular Farming)
 

Plus de ILRI

How the small-scale low biosecurity sector could be transformed into a more b...
How the small-scale low biosecurity sector could be transformed into a more b...How the small-scale low biosecurity sector could be transformed into a more b...
How the small-scale low biosecurity sector could be transformed into a more b...ILRI
 
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...ILRI
 
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...ILRI
 
A training, certification and marketing scheme for informal dairy vendors in ...
A training, certification and marketing scheme for informal dairy vendors in ...A training, certification and marketing scheme for informal dairy vendors in ...
A training, certification and marketing scheme for informal dairy vendors in ...ILRI
 
Milk safety and child nutrition impacts of the MoreMilk training, certificati...
Milk safety and child nutrition impacts of the MoreMilk training, certificati...Milk safety and child nutrition impacts of the MoreMilk training, certificati...
Milk safety and child nutrition impacts of the MoreMilk training, certificati...ILRI
 
Preventing the next pandemic: a 12-slide primer on emerging zoonotic diseases
Preventing the next pandemic: a 12-slide primer on emerging zoonotic diseasesPreventing the next pandemic: a 12-slide primer on emerging zoonotic diseases
Preventing the next pandemic: a 12-slide primer on emerging zoonotic diseasesILRI
 
Preventing preventable diseases: a 12-slide primer on foodborne disease
Preventing preventable diseases: a 12-slide primer on foodborne diseasePreventing preventable diseases: a 12-slide primer on foodborne disease
Preventing preventable diseases: a 12-slide primer on foodborne diseaseILRI
 
Preventing a post-antibiotic era: a 12-slide primer on antimicrobial resistance
Preventing a post-antibiotic era: a 12-slide primer on antimicrobial resistancePreventing a post-antibiotic era: a 12-slide primer on antimicrobial resistance
Preventing a post-antibiotic era: a 12-slide primer on antimicrobial resistanceILRI
 
Food safety research in low- and middle-income countries
Food safety research in low- and middle-income countriesFood safety research in low- and middle-income countries
Food safety research in low- and middle-income countriesILRI
 
Food safety research LMIC
Food safety research LMICFood safety research LMIC
Food safety research LMICILRI
 
The application of One Health: Observations from eastern and southern Africa
The application of One Health: Observations from eastern and southern AfricaThe application of One Health: Observations from eastern and southern Africa
The application of One Health: Observations from eastern and southern AfricaILRI
 
One Health in action: Perspectives from 10 years in the field
One Health in action: Perspectives from 10 years in the fieldOne Health in action: Perspectives from 10 years in the field
One Health in action: Perspectives from 10 years in the fieldILRI
 
Reservoirs of pathogenic Leptospira species in Uganda
Reservoirs of pathogenic Leptospira species in UgandaReservoirs of pathogenic Leptospira species in Uganda
Reservoirs of pathogenic Leptospira species in UgandaILRI
 
Minyoo ya mbwa
Minyoo ya mbwaMinyoo ya mbwa
Minyoo ya mbwaILRI
 
Parasites in dogs
Parasites in dogsParasites in dogs
Parasites in dogsILRI
 
Assessing meat microbiological safety and associated handling practices in bu...
Assessing meat microbiological safety and associated handling practices in bu...Assessing meat microbiological safety and associated handling practices in bu...
Assessing meat microbiological safety and associated handling practices in bu...ILRI
 
Ecological factors associated with abundance and distribution of mosquito vec...
Ecological factors associated with abundance and distribution of mosquito vec...Ecological factors associated with abundance and distribution of mosquito vec...
Ecological factors associated with abundance and distribution of mosquito vec...ILRI
 
Livestock in the agrifood systems transformation
Livestock in the agrifood systems transformationLivestock in the agrifood systems transformation
Livestock in the agrifood systems transformationILRI
 
Development of a fluorescent RBL reporter system for diagnosis of porcine cys...
Development of a fluorescent RBL reporter system for diagnosis of porcine cys...Development of a fluorescent RBL reporter system for diagnosis of porcine cys...
Development of a fluorescent RBL reporter system for diagnosis of porcine cys...ILRI
 
Practices and drivers of antibiotic use in Kenyan smallholder dairy farms
Practices and drivers of antibiotic use in Kenyan smallholder dairy farmsPractices and drivers of antibiotic use in Kenyan smallholder dairy farms
Practices and drivers of antibiotic use in Kenyan smallholder dairy farmsILRI
 

Plus de ILRI (20)

How the small-scale low biosecurity sector could be transformed into a more b...
How the small-scale low biosecurity sector could be transformed into a more b...How the small-scale low biosecurity sector could be transformed into a more b...
How the small-scale low biosecurity sector could be transformed into a more b...
 
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...
 
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...
 
A training, certification and marketing scheme for informal dairy vendors in ...
A training, certification and marketing scheme for informal dairy vendors in ...A training, certification and marketing scheme for informal dairy vendors in ...
A training, certification and marketing scheme for informal dairy vendors in ...
 
Milk safety and child nutrition impacts of the MoreMilk training, certificati...
Milk safety and child nutrition impacts of the MoreMilk training, certificati...Milk safety and child nutrition impacts of the MoreMilk training, certificati...
Milk safety and child nutrition impacts of the MoreMilk training, certificati...
 
Preventing the next pandemic: a 12-slide primer on emerging zoonotic diseases
Preventing the next pandemic: a 12-slide primer on emerging zoonotic diseasesPreventing the next pandemic: a 12-slide primer on emerging zoonotic diseases
Preventing the next pandemic: a 12-slide primer on emerging zoonotic diseases
 
Preventing preventable diseases: a 12-slide primer on foodborne disease
Preventing preventable diseases: a 12-slide primer on foodborne diseasePreventing preventable diseases: a 12-slide primer on foodborne disease
Preventing preventable diseases: a 12-slide primer on foodborne disease
 
Preventing a post-antibiotic era: a 12-slide primer on antimicrobial resistance
Preventing a post-antibiotic era: a 12-slide primer on antimicrobial resistancePreventing a post-antibiotic era: a 12-slide primer on antimicrobial resistance
Preventing a post-antibiotic era: a 12-slide primer on antimicrobial resistance
 
Food safety research in low- and middle-income countries
Food safety research in low- and middle-income countriesFood safety research in low- and middle-income countries
Food safety research in low- and middle-income countries
 
Food safety research LMIC
Food safety research LMICFood safety research LMIC
Food safety research LMIC
 
The application of One Health: Observations from eastern and southern Africa
The application of One Health: Observations from eastern and southern AfricaThe application of One Health: Observations from eastern and southern Africa
The application of One Health: Observations from eastern and southern Africa
 
One Health in action: Perspectives from 10 years in the field
One Health in action: Perspectives from 10 years in the fieldOne Health in action: Perspectives from 10 years in the field
One Health in action: Perspectives from 10 years in the field
 
Reservoirs of pathogenic Leptospira species in Uganda
Reservoirs of pathogenic Leptospira species in UgandaReservoirs of pathogenic Leptospira species in Uganda
Reservoirs of pathogenic Leptospira species in Uganda
 
Minyoo ya mbwa
Minyoo ya mbwaMinyoo ya mbwa
Minyoo ya mbwa
 
Parasites in dogs
Parasites in dogsParasites in dogs
Parasites in dogs
 
Assessing meat microbiological safety and associated handling practices in bu...
Assessing meat microbiological safety and associated handling practices in bu...Assessing meat microbiological safety and associated handling practices in bu...
Assessing meat microbiological safety and associated handling practices in bu...
 
Ecological factors associated with abundance and distribution of mosquito vec...
Ecological factors associated with abundance and distribution of mosquito vec...Ecological factors associated with abundance and distribution of mosquito vec...
Ecological factors associated with abundance and distribution of mosquito vec...
 
Livestock in the agrifood systems transformation
Livestock in the agrifood systems transformationLivestock in the agrifood systems transformation
Livestock in the agrifood systems transformation
 
Development of a fluorescent RBL reporter system for diagnosis of porcine cys...
Development of a fluorescent RBL reporter system for diagnosis of porcine cys...Development of a fluorescent RBL reporter system for diagnosis of porcine cys...
Development of a fluorescent RBL reporter system for diagnosis of porcine cys...
 
Practices and drivers of antibiotic use in Kenyan smallholder dairy farms
Practices and drivers of antibiotic use in Kenyan smallholder dairy farmsPractices and drivers of antibiotic use in Kenyan smallholder dairy farms
Practices and drivers of antibiotic use in Kenyan smallholder dairy farms
 

Dernier

Zoology 4th semester series (krishna).pdf
Zoology 4th semester series (krishna).pdfZoology 4th semester series (krishna).pdf
Zoology 4th semester series (krishna).pdfSumit Kumar yadav
 
TEST BANK For Radiologic Science for Technologists, 12th Edition by Stewart C...
TEST BANK For Radiologic Science for Technologists, 12th Edition by Stewart C...TEST BANK For Radiologic Science for Technologists, 12th Edition by Stewart C...
TEST BANK For Radiologic Science for Technologists, 12th Edition by Stewart C...ssifa0344
 
Botany 4th semester file By Sumit Kumar yadav.pdf
Botany 4th semester file By Sumit Kumar yadav.pdfBotany 4th semester file By Sumit Kumar yadav.pdf
Botany 4th semester file By Sumit Kumar yadav.pdfSumit Kumar yadav
 
Isotopic evidence of long-lived volcanism on Io
Isotopic evidence of long-lived volcanism on IoIsotopic evidence of long-lived volcanism on Io
Isotopic evidence of long-lived volcanism on IoSérgio Sacani
 
Disentangling the origin of chemical differences using GHOST
Disentangling the origin of chemical differences using GHOSTDisentangling the origin of chemical differences using GHOST
Disentangling the origin of chemical differences using GHOSTSérgio Sacani
 
Hubble Asteroid Hunter III. Physical properties of newly found asteroids
Hubble Asteroid Hunter III. Physical properties of newly found asteroidsHubble Asteroid Hunter III. Physical properties of newly found asteroids
Hubble Asteroid Hunter III. Physical properties of newly found asteroidsSérgio Sacani
 
Nanoparticles synthesis and characterization​ ​
Nanoparticles synthesis and characterization​  ​Nanoparticles synthesis and characterization​  ​
Nanoparticles synthesis and characterization​ ​kaibalyasahoo82800
 
GFP in rDNA Technology (Biotechnology).pptx
GFP in rDNA Technology (Biotechnology).pptxGFP in rDNA Technology (Biotechnology).pptx
GFP in rDNA Technology (Biotechnology).pptxAleenaTreesaSaji
 
Green chemistry and Sustainable development.pptx
Green chemistry  and Sustainable development.pptxGreen chemistry  and Sustainable development.pptx
Green chemistry and Sustainable development.pptxRajatChauhan518211
 
Cultivation of KODO MILLET . made by Ghanshyam pptx
Cultivation of KODO MILLET . made by Ghanshyam pptxCultivation of KODO MILLET . made by Ghanshyam pptx
Cultivation of KODO MILLET . made by Ghanshyam pptxpradhanghanshyam7136
 
Stunning ➥8448380779▻ Call Girls In Panchshil Enclave Delhi NCR
Stunning ➥8448380779▻ Call Girls In Panchshil Enclave Delhi NCRStunning ➥8448380779▻ Call Girls In Panchshil Enclave Delhi NCR
Stunning ➥8448380779▻ Call Girls In Panchshil Enclave Delhi NCRDelhi Call girls
 
Biological Classification BioHack (3).pdf
Biological Classification BioHack (3).pdfBiological Classification BioHack (3).pdf
Biological Classification BioHack (3).pdfmuntazimhurra
 
Orientation, design and principles of polyhouse
Orientation, design and principles of polyhouseOrientation, design and principles of polyhouse
Orientation, design and principles of polyhousejana861314
 
Botany krishna series 2nd semester Only Mcq type questions
Botany krishna series 2nd semester Only Mcq type questionsBotany krishna series 2nd semester Only Mcq type questions
Botany krishna series 2nd semester Only Mcq type questionsSumit Kumar yadav
 
Botany 4th semester series (krishna).pdf
Botany 4th semester series (krishna).pdfBotany 4th semester series (krishna).pdf
Botany 4th semester series (krishna).pdfSumit Kumar yadav
 
Formation of low mass protostars and their circumstellar disks
Formation of low mass protostars and their circumstellar disksFormation of low mass protostars and their circumstellar disks
Formation of low mass protostars and their circumstellar disksSérgio Sacani
 
Pests of cotton_Sucking_Pests_Dr.UPR.pdf
Pests of cotton_Sucking_Pests_Dr.UPR.pdfPests of cotton_Sucking_Pests_Dr.UPR.pdf
Pests of cotton_Sucking_Pests_Dr.UPR.pdfPirithiRaju
 
Traditional Agroforestry System in India- Shifting Cultivation, Taungya, Home...
Traditional Agroforestry System in India- Shifting Cultivation, Taungya, Home...Traditional Agroforestry System in India- Shifting Cultivation, Taungya, Home...
Traditional Agroforestry System in India- Shifting Cultivation, Taungya, Home...jana861314
 

Dernier (20)

Zoology 4th semester series (krishna).pdf
Zoology 4th semester series (krishna).pdfZoology 4th semester series (krishna).pdf
Zoology 4th semester series (krishna).pdf
 
TEST BANK For Radiologic Science for Technologists, 12th Edition by Stewart C...
TEST BANK For Radiologic Science for Technologists, 12th Edition by Stewart C...TEST BANK For Radiologic Science for Technologists, 12th Edition by Stewart C...
TEST BANK For Radiologic Science for Technologists, 12th Edition by Stewart C...
 
Botany 4th semester file By Sumit Kumar yadav.pdf
Botany 4th semester file By Sumit Kumar yadav.pdfBotany 4th semester file By Sumit Kumar yadav.pdf
Botany 4th semester file By Sumit Kumar yadav.pdf
 
Isotopic evidence of long-lived volcanism on Io
Isotopic evidence of long-lived volcanism on IoIsotopic evidence of long-lived volcanism on Io
Isotopic evidence of long-lived volcanism on Io
 
CELL -Structural and Functional unit of life.pdf
CELL -Structural and Functional unit of life.pdfCELL -Structural and Functional unit of life.pdf
CELL -Structural and Functional unit of life.pdf
 
Disentangling the origin of chemical differences using GHOST
Disentangling the origin of chemical differences using GHOSTDisentangling the origin of chemical differences using GHOST
Disentangling the origin of chemical differences using GHOST
 
Hubble Asteroid Hunter III. Physical properties of newly found asteroids
Hubble Asteroid Hunter III. Physical properties of newly found asteroidsHubble Asteroid Hunter III. Physical properties of newly found asteroids
Hubble Asteroid Hunter III. Physical properties of newly found asteroids
 
Nanoparticles synthesis and characterization​ ​
Nanoparticles synthesis and characterization​  ​Nanoparticles synthesis and characterization​  ​
Nanoparticles synthesis and characterization​ ​
 
Engler and Prantl system of classification in plant taxonomy
Engler and Prantl system of classification in plant taxonomyEngler and Prantl system of classification in plant taxonomy
Engler and Prantl system of classification in plant taxonomy
 
GFP in rDNA Technology (Biotechnology).pptx
GFP in rDNA Technology (Biotechnology).pptxGFP in rDNA Technology (Biotechnology).pptx
GFP in rDNA Technology (Biotechnology).pptx
 
Green chemistry and Sustainable development.pptx
Green chemistry  and Sustainable development.pptxGreen chemistry  and Sustainable development.pptx
Green chemistry and Sustainable development.pptx
 
Cultivation of KODO MILLET . made by Ghanshyam pptx
Cultivation of KODO MILLET . made by Ghanshyam pptxCultivation of KODO MILLET . made by Ghanshyam pptx
Cultivation of KODO MILLET . made by Ghanshyam pptx
 
Stunning ➥8448380779▻ Call Girls In Panchshil Enclave Delhi NCR
Stunning ➥8448380779▻ Call Girls In Panchshil Enclave Delhi NCRStunning ➥8448380779▻ Call Girls In Panchshil Enclave Delhi NCR
Stunning ➥8448380779▻ Call Girls In Panchshil Enclave Delhi NCR
 
Biological Classification BioHack (3).pdf
Biological Classification BioHack (3).pdfBiological Classification BioHack (3).pdf
Biological Classification BioHack (3).pdf
 
Orientation, design and principles of polyhouse
Orientation, design and principles of polyhouseOrientation, design and principles of polyhouse
Orientation, design and principles of polyhouse
 
Botany krishna series 2nd semester Only Mcq type questions
Botany krishna series 2nd semester Only Mcq type questionsBotany krishna series 2nd semester Only Mcq type questions
Botany krishna series 2nd semester Only Mcq type questions
 
Botany 4th semester series (krishna).pdf
Botany 4th semester series (krishna).pdfBotany 4th semester series (krishna).pdf
Botany 4th semester series (krishna).pdf
 
Formation of low mass protostars and their circumstellar disks
Formation of low mass protostars and their circumstellar disksFormation of low mass protostars and their circumstellar disks
Formation of low mass protostars and their circumstellar disks
 
Pests of cotton_Sucking_Pests_Dr.UPR.pdf
Pests of cotton_Sucking_Pests_Dr.UPR.pdfPests of cotton_Sucking_Pests_Dr.UPR.pdf
Pests of cotton_Sucking_Pests_Dr.UPR.pdf
 
Traditional Agroforestry System in India- Shifting Cultivation, Taungya, Home...
Traditional Agroforestry System in India- Shifting Cultivation, Taungya, Home...Traditional Agroforestry System in India- Shifting Cultivation, Taungya, Home...
Traditional Agroforestry System in India- Shifting Cultivation, Taungya, Home...
 

Vision for livestock genetics in Africa

  • 1. • Vision for livestock genetics in Africa • Steve Kemp, ILRI Animal Genetic Research for Africa (Biosciences for Farming in Africa), Nairobi, 10-11 September 2015
  • 2. Genetic selection, interacting with environment, drives ‘improvement’ -1000 0 1000 2000 3000 4000 5000 6000 7000 1950 1960 1970 1980 1990 2000 2010 Year Changeinmilkyield(kg) (Source: http://aipl.arsusda.gov/eval/summary/trend.cfm) Changes in milk yields of US Holstein cows Mean phenotype (P), breeding value (A) and environmental effects (E = A - P). Results relative to 1957 base (mean yield 5859kg). A P E In the industrial world genetics has driven dramatic improvements in productivity • Homogeneous environments (systems, markets, health, regulations, policies…….) • Homogeneous genetics (a handful of well defined breeds) • Superb data recording driving selection schemes
  • 3. Achieving genetic gain in developing countries – the same biological rules but different environments We must take account of the realities of small-scale livestock producers. Diversity of: • Environment • Climate • Feeds available • Endemic diseases • Local market context • Infrastructure • Institutions
  • 4. Achieving genetic gain in developing countries – the same biological rules but different environments We must take account of the realities of small-scale livestock producers. Diversity of: • Environment • Climate • Feeds available • Endemic diseases • Local market context • Infrastructure • Institutions No data systems to inform selection. No infrastructure to manage selection.
  • 5. Genotype data is cheap and easy to obtain. Phenotype data remains a problem. Can we skip a generation of technology? • Fast, light, cheap performance data harvesting. • Cheap sensors, mobile platforms, crowd sensing….. • Simultaneously providing management information to the farmer and performance data to the breeder.
  • 6. Diversity of environments has created diversity of genetics. Let’s not discard it.
  • 7. African Trypanosomiasis • Caused by extracellular protozoan parasites – Trypanosoma • Transmitted between mammals by Tsetse flies (Glossina sp.) • Prevalent in 36 countries of sub-Sahara Africa. In cattle • A chronic debilitating and fatal disease. • A major constraint on livestock and agricultural production in Africa. • Costs US$ 1 billion annually. In human (Human Sleeping Sickness) • Fatal • 60,000 people die every year • Both wild and domestic animals are the major reservoir of the parasites for human infection. African Trypanosomiasis
  • 8. Control and Treatment options for African Trypanosomiasis Vector Control (Tsetse Fly) • Using toxic insecticide • Not sustainable • Negative impacts on environment Vaccine • Tryps periodically change the major surface antigen – variant surface glycoprotein (VSG) and evade the host immune system. • More than 2 decades, there is no effective vaccine developed. Drug • Drug toxicity and resistance • Expensive
  • 9. New tools allow us to look in new places for sources of variation – including wildlife Comparative gene network and sequence analysis allows to ask new kinds of questions about genomes – eg “what is different about this (group of) species compared to all other mammals” “traditional” linkage mapping requires crosses – so initial discovery is limited to variants within a species Cow NDama KFITRRPSLKTLQEKGLIKDQIFGSPLHTLCEREKSTVPRFVKQCIEAVEK Cow Boran KFITRRPSLKTLQEKGLIKDQIFGSHLHTLCEREKSTVPRFVKQCIEAVEK Human KFISRRPSLKTLQEKGLIKDQIFGSHLHTVCEREHSTVPWFVKQCIEAVEK Pig KFITRRPSLKTLQEKGLIKDQIFGSHLHTVCERENSTVPRFVKQCIEAVEK Chicken KFISRRPSLKTLQEKGLIKDQIFGSHLHLVCEHENSTVPQFVRQCIKAVER Salmon KFISRRPSMKTLQEKGIIKDRVFGCHLLALCEREGTTVPKFVRQCVEAVEK
  • 10. Time for a new search for variation underlying tropical adaptation and productivity Identify and make use of the genetics underlying natural variation. There has been no systematic search for the genomic basis of adaptation. Because until now we have had no validation tools and no delivery tools. New Genome Editing tools change the landscape.
  • 11. Identify and deliver variants associated with adaptation GenotypingPhenotyping Adapted & productive livestock Genome editing Targeting Data systems Delivery systems
  • 12. TLF ApoL-I • Apolipoprotein • Trypanolytic component Hpr • Haptoglobin-related protein • Facilitates the uptake of TLF by trypanosomes via haptoglobin-hemoglobin receptor. ApoL-I released Activated in acidic lysosome Form membrane pores, resulting in ion disregulation and osmotic imbalance Trypanosomes lysis Endocytosed into lysosome by Trypanosomes ApoA-I • Apolipoprotein • Found in all HDL subclasses Killing of Tryps by Trypanosome Lytic Factor (TLF) Flagellar pocket of Tryp
  • 13. Complete protection from Trypanosomes by baboon ApoL-I in transiently transgenic mice 0 20 40 60 80 100 120 140 0 20 40 60 80 100 Vector (N=6) apoL-I + Hpr (N=5) apoL-I (N=5) * * Days post infection • P = < 0.01 • Vector vs. treatment Thomson et al PNAS 2009 106:19509-19514
  • 14. Project Strategy Genomic locus of Baboon apoL-I gene Vector construction Validate the construct in transgenic mouse Bovine embryonic fibroblasts (BEF) primary culture Transfection & screening apoL-I Transgenic BEFs Nuclear Transfer Transgenic calves Phenotyping Trypanosome resistant transgenic Boran bull ILRI ILRI Kenya Boran Roslin Institute New York University Michigan State University
  • 15. Tumaini A cloned Kenya Boran calf made by SCNT from a Boran embryo fibroblast cell line
  • 16. 20
  • 17. The presentation has a Creative Commons licence. You are free to re-use or distribute this work, provided credit is given to ILRI. better lives through livestock ilri.org http://vimeo.com/74942619 11 minute version Video ‘Developing disease-resistant cattle for Africa’ http://vimeo.com/74940697 3 minute version

Notes de l'éditeur

  1. Overlay diversity of disease, culture, market access, market demands, policy……..
  2. Trypanosomes live and multiply extracellularly in blood and tissue fluids Distribution corresponds to the distribution of Tsetse flies
  3. Antigenic variation is transcriptional switching from one VSG gene to another.
  4. ‘old fashioned’ genome mapping identified variants – slow and costly. But nowhere to go with it New big data approaches allow us to look in new ways. And now we have genome editing to validate and deliver. TIME FOR A NEW ROUND OF FUNCTIONAL GENOMICS TO UNDERSTAND ADAPTATION