SlideShare une entreprise Scribd logo
1  sur  18
INTRODUCTION
The culture of India is the way of living of the people
of India.
India's languages, religions, dance, music, architecture,
food, and customs differ from place to place within the
country. The Indian culture, often labeled as an
amalgamation of several cultures, spans across
the Indian subcontinent and has been influenced by a
history that is several millennia old. Many elements of
India's diverse cultures, such as Indian
religions, yoga and Indian cuisine, have had a profound
impact across the world.
India is the birthplace
of Hinduism, Buddhism, Jainism and Sikh
ism, collectively known as Indian
religions. Indian religions are a major
form of world religions.
India is one of the most religiously diverse
nations in the world, with some of the
most deeply religious societies and
cultures. Religion plays a central and
definitive role in the life of many of its
people.
 Spiritualityandmysticalcharmhavealwaysdrawnpeoplefromall
overtheworldtoIndia.numerousculturesandreligionshavethrived
andflourishedtogetherforagesandresultedintotheuniqueIndian
wayoflife.
 Thus,Indianspiritualityisallaboutshowingrespecttoallliving
beings-animalstrees,rocksandevenwaterandleadapositiveand
healthylife.
India has 22 official languages – 15 of which are Indo-European.
Sanskrit has had a profound impact on the languages and
literature of India. Hindi is the most spoken language in India,
followed by Bengali, Telugu, Marathi, Tamil and Urdu.
In contemporary Indian literature, there are two major literary
awards; these are the Sahitya Akademi Fellowship and the
Jnanpith Award. Eight Jnanpith awards have been awarded in
Kannada, six in Hindi, five in Bengali, four in Oriya and
Malayalam, three each in Marathi, Gujarati, Urduand Telugu
and two each in Assamese, and Tamil.
 Indian cuisine is diverse, ranging from very
spicy to very mild, varying with seasons in
each region. Indian food is as diverse as
India. Indian cuisines use numerous
ingredients, deploy a wide range of food
preparation styles, cooking techniques and
culinary presentation. From salads to
sauces, from vegetarian to meat, from spices
to sensuous, from breads to desserts.
Bengali Punjabi Gujarati
South
Indian
Rajasthani
 For centuries, arranged marriages have been the
tradition in Indian society. Even today, the
majority of Indians have their marriages planned
by their parents and other respected family-
members. In most marriages the bride's family
provide a dowry to the bridegroom.
 India, being a multi-cultural and multi-religious
society, celebrates holidays and festivals of various
religions. The three national holidays in India, the
Independence Day, the Republic Day and the Gandhi
Jayanti, are celebrated with zeal and enthusiasm
across India. Regional fairs are also common and
festive in India. For example, Pushkar fair is one of the
world's largest markets.
 The Rāmāyaṇa and the Mahabharata are the oldest preserved
and well-known epics of India. The Ramayana consists of
24,000 verses in seven books (kāṇḍas) and 500 cantos (sargas),
and tells the story of Rama (an incarnation or Avatar of the
Hindu preserver-god Vishnu), whose wife Sita is abducted by
the demon king of Lanka, Ravana. Mahabharata text date to 400
BC and is estimated to have reached its final form by the early
Gupta period (c. 4th century AD).
 The first sculptures in India date back to the Indus Valley
civilization, where stone and bronze figures have been
discovered. Later, as Hinduism, Buddhism, and Jainism
developed further, India produced some extremely intricate
bronzes as well as temple carvings. Some huge shrines, such
as the one at Ellora were not constructed by using blocks but
carved out of solid rock.
 Indian architecture encompasses a multitude of expressions
over space and time, constantly absorbing new ideas. The
result is an evolving range of architectural production that
nonetheless retains a certain amount of continuity across
history. Some of its earliest production are found in the Indus
Valley Civilization (2600–1900 BC) which is characterized by
well planned cities and houses.
 Cave paintings from Ajanta, Bagh, Ellora and
Sittanavasal and temple paintings testify to a love
of naturalism. Most early and medieval art in
India is Hindu, Buddhist or Jain. A freshly made
colored floor design (Rangoli) is still a common
sight outside the doorstep of many (mostly South
Indian) Indian homes.
 The written history of agriculture in India dates back
to the Rigveda, written about 1100 BC. Today,
India ranks second worldwide in farm
output. Agriculture and allied sectors
like forestry and fisheries accounted for 13.7% of
the GDP(Gross Domestic Product) in 2013,about 50%
of the total workforce.
 Traditional clothing in India greatly varies across
different parts of the country and is influenced by
local culture, geography, climate and rural/urban
settings. Popular styles of dress include draped
garments such as sari for women and dhoti or lungi
or panche for men. Bindi is often an essential part of
a Hindu woman's make up. Worn on their forehead,
some consider the bindi as an auspicious mark.
MADE BY- KRISHNA AGRAWAL
CLASS-VIII D

Contenu connexe

Tendances (20)

Cultures of india
Cultures of indiaCultures of india
Cultures of india
 
Indian culture
Indian cultureIndian culture
Indian culture
 
Indian culture
Indian culture  Indian culture
Indian culture
 
Indian culture
Indian cultureIndian culture
Indian culture
 
Diversity in india
Diversity in india Diversity in india
Diversity in india
 
Indian_cultural_heritage
Indian_cultural_heritageIndian_cultural_heritage
Indian_cultural_heritage
 
Culture of India!
Culture of India!Culture of India!
Culture of India!
 
India's cultural heritage
India's cultural heritageIndia's cultural heritage
India's cultural heritage
 
Indian tradition & Culture
Indian tradition & CultureIndian tradition & Culture
Indian tradition & Culture
 
Presentation India
Presentation IndiaPresentation India
Presentation India
 
India
IndiaIndia
India
 
Indian heritage
Indian heritageIndian heritage
Indian heritage
 
Unity in diversity in India
Unity in diversity in IndiaUnity in diversity in India
Unity in diversity in India
 
CULTURES OF INDIA
CULTURES OF INDIACULTURES OF INDIA
CULTURES OF INDIA
 
PPT on festivals
PPT on festivalsPPT on festivals
PPT on festivals
 
Indian culture
Indian culture Indian culture
Indian culture
 
Festival Of India ppt
Festival Of India pptFestival Of India ppt
Festival Of India ppt
 
Indian cultural heritage
Indian cultural heritageIndian cultural heritage
Indian cultural heritage
 
About india
About indiaAbout india
About india
 
Indian culture
Indian cultureIndian culture
Indian culture
 

Similaire à Indian culture nd tradition

Similaire à Indian culture nd tradition (20)

Indian Cultures
Indian CulturesIndian Cultures
Indian Cultures
 
INDIA_CULTURE_EXCHANGE_PROGRAM_2016-17
INDIA_CULTURE_EXCHANGE_PROGRAM_2016-17INDIA_CULTURE_EXCHANGE_PROGRAM_2016-17
INDIA_CULTURE_EXCHANGE_PROGRAM_2016-17
 
Indian culture
Indian cultureIndian culture
Indian culture
 
Indian culture
Indian cultureIndian culture
Indian culture
 
INDIAN CULTURE
INDIAN CULTUREINDIAN CULTURE
INDIAN CULTURE
 
My country india
My country indiaMy country india
My country india
 
Diversity of india.pptx
Diversity of india.pptxDiversity of india.pptx
Diversity of india.pptx
 
Jazz
JazzJazz
Jazz
 
India : Unity in diversity
India : Unity in diversityIndia : Unity in diversity
India : Unity in diversity
 
Cnc India Civilisation
Cnc India CivilisationCnc India Civilisation
Cnc India Civilisation
 
Indian culture (nabeel__kp__)
Indian culture (nabeel__kp__)Indian culture (nabeel__kp__)
Indian culture (nabeel__kp__)
 
Legacy of india
Legacy of india Legacy of india
Legacy of india
 
Cultural Heritage of India_by Suparna Roy
Cultural Heritage of India_by Suparna RoyCultural Heritage of India_by Suparna Roy
Cultural Heritage of India_by Suparna Roy
 
Indianculturepptfinal 130225123456-phpapp01
Indianculturepptfinal 130225123456-phpapp01Indianculturepptfinal 130225123456-phpapp01
Indianculturepptfinal 130225123456-phpapp01
 
Indiancultureppt
IndianculturepptIndiancultureppt
Indiancultureppt
 
Article manadhi
Article manadhiArticle manadhi
Article manadhi
 
Indian culture
Indian cultureIndian culture
Indian culture
 
Akshay ppt 1
Akshay ppt 1Akshay ppt 1
Akshay ppt 1
 
Inde Un Grand Pays/ India a great country
Inde Un Grand  Pays/ India a great countryInde Un Grand  Pays/ India a great country
Inde Un Grand Pays/ India a great country
 
Ind Yeah
Ind YeahInd Yeah
Ind Yeah
 

Dernier

UGC NET Paper 1 Mathematical Reasoning & Aptitude.pdf
UGC NET Paper 1 Mathematical Reasoning & Aptitude.pdfUGC NET Paper 1 Mathematical Reasoning & Aptitude.pdf
UGC NET Paper 1 Mathematical Reasoning & Aptitude.pdfNirmal Dwivedi
 
Micro-Scholarship, What it is, How can it help me.pdf
Micro-Scholarship, What it is, How can it help me.pdfMicro-Scholarship, What it is, How can it help me.pdf
Micro-Scholarship, What it is, How can it help me.pdfPoh-Sun Goh
 
NO1 Top Black Magic Specialist In Lahore Black magic In Pakistan Kala Ilam Ex...
NO1 Top Black Magic Specialist In Lahore Black magic In Pakistan Kala Ilam Ex...NO1 Top Black Magic Specialist In Lahore Black magic In Pakistan Kala Ilam Ex...
NO1 Top Black Magic Specialist In Lahore Black magic In Pakistan Kala Ilam Ex...Amil baba
 
Salient Features of India constitution especially power and functions
Salient Features of India constitution especially power and functionsSalient Features of India constitution especially power and functions
Salient Features of India constitution especially power and functionsKarakKing
 
How to Give a Domain for a Field in Odoo 17
How to Give a Domain for a Field in Odoo 17How to Give a Domain for a Field in Odoo 17
How to Give a Domain for a Field in Odoo 17Celine George
 
COMMUNICATING NEGATIVE NEWS - APPROACHES .pptx
COMMUNICATING NEGATIVE NEWS - APPROACHES .pptxCOMMUNICATING NEGATIVE NEWS - APPROACHES .pptx
COMMUNICATING NEGATIVE NEWS - APPROACHES .pptxannathomasp01
 
The basics of sentences session 3pptx.pptx
The basics of sentences session 3pptx.pptxThe basics of sentences session 3pptx.pptx
The basics of sentences session 3pptx.pptxheathfieldcps1
 
Fostering Friendships - Enhancing Social Bonds in the Classroom
Fostering Friendships - Enhancing Social Bonds  in the ClassroomFostering Friendships - Enhancing Social Bonds  in the Classroom
Fostering Friendships - Enhancing Social Bonds in the ClassroomPooky Knightsmith
 
REMIFENTANIL: An Ultra short acting opioid.pptx
REMIFENTANIL: An Ultra short acting opioid.pptxREMIFENTANIL: An Ultra short acting opioid.pptx
REMIFENTANIL: An Ultra short acting opioid.pptxDr. Ravikiran H M Gowda
 
Holdier Curriculum Vitae (April 2024).pdf
Holdier Curriculum Vitae (April 2024).pdfHoldier Curriculum Vitae (April 2024).pdf
Holdier Curriculum Vitae (April 2024).pdfagholdier
 
SOC 101 Demonstration of Learning Presentation
SOC 101 Demonstration of Learning PresentationSOC 101 Demonstration of Learning Presentation
SOC 101 Demonstration of Learning Presentationcamerronhm
 
Single or Multiple melodic lines structure
Single or Multiple melodic lines structureSingle or Multiple melodic lines structure
Single or Multiple melodic lines structuredhanjurrannsibayan2
 
On_Translating_a_Tamil_Poem_by_A_K_Ramanujan.pptx
On_Translating_a_Tamil_Poem_by_A_K_Ramanujan.pptxOn_Translating_a_Tamil_Poem_by_A_K_Ramanujan.pptx
On_Translating_a_Tamil_Poem_by_A_K_Ramanujan.pptxPooja Bhuva
 
Sensory_Experience_and_Emotional_Resonance_in_Gabriel_Okaras_The_Piano_and_Th...
Sensory_Experience_and_Emotional_Resonance_in_Gabriel_Okaras_The_Piano_and_Th...Sensory_Experience_and_Emotional_Resonance_in_Gabriel_Okaras_The_Piano_and_Th...
Sensory_Experience_and_Emotional_Resonance_in_Gabriel_Okaras_The_Piano_and_Th...Pooja Bhuva
 
Kodo Millet PPT made by Ghanshyam bairwa college of Agriculture kumher bhara...
Kodo Millet  PPT made by Ghanshyam bairwa college of Agriculture kumher bhara...Kodo Millet  PPT made by Ghanshyam bairwa college of Agriculture kumher bhara...
Kodo Millet PPT made by Ghanshyam bairwa college of Agriculture kumher bhara...pradhanghanshyam7136
 
HMCS Max Bernays Pre-Deployment Brief (May 2024).pptx
HMCS Max Bernays Pre-Deployment Brief (May 2024).pptxHMCS Max Bernays Pre-Deployment Brief (May 2024).pptx
HMCS Max Bernays Pre-Deployment Brief (May 2024).pptxEsquimalt MFRC
 
How to Add New Custom Addons Path in Odoo 17
How to Add New Custom Addons Path in Odoo 17How to Add New Custom Addons Path in Odoo 17
How to Add New Custom Addons Path in Odoo 17Celine George
 
Wellbeing inclusion and digital dystopias.pptx
Wellbeing inclusion and digital dystopias.pptxWellbeing inclusion and digital dystopias.pptx
Wellbeing inclusion and digital dystopias.pptxJisc
 
Plant propagation: Sexual and Asexual propapagation.pptx
Plant propagation: Sexual and Asexual propapagation.pptxPlant propagation: Sexual and Asexual propapagation.pptx
Plant propagation: Sexual and Asexual propapagation.pptxUmeshTimilsina1
 
Application orientated numerical on hev.ppt
Application orientated numerical on hev.pptApplication orientated numerical on hev.ppt
Application orientated numerical on hev.pptRamjanShidvankar
 

Dernier (20)

UGC NET Paper 1 Mathematical Reasoning & Aptitude.pdf
UGC NET Paper 1 Mathematical Reasoning & Aptitude.pdfUGC NET Paper 1 Mathematical Reasoning & Aptitude.pdf
UGC NET Paper 1 Mathematical Reasoning & Aptitude.pdf
 
Micro-Scholarship, What it is, How can it help me.pdf
Micro-Scholarship, What it is, How can it help me.pdfMicro-Scholarship, What it is, How can it help me.pdf
Micro-Scholarship, What it is, How can it help me.pdf
 
NO1 Top Black Magic Specialist In Lahore Black magic In Pakistan Kala Ilam Ex...
NO1 Top Black Magic Specialist In Lahore Black magic In Pakistan Kala Ilam Ex...NO1 Top Black Magic Specialist In Lahore Black magic In Pakistan Kala Ilam Ex...
NO1 Top Black Magic Specialist In Lahore Black magic In Pakistan Kala Ilam Ex...
 
Salient Features of India constitution especially power and functions
Salient Features of India constitution especially power and functionsSalient Features of India constitution especially power and functions
Salient Features of India constitution especially power and functions
 
How to Give a Domain for a Field in Odoo 17
How to Give a Domain for a Field in Odoo 17How to Give a Domain for a Field in Odoo 17
How to Give a Domain for a Field in Odoo 17
 
COMMUNICATING NEGATIVE NEWS - APPROACHES .pptx
COMMUNICATING NEGATIVE NEWS - APPROACHES .pptxCOMMUNICATING NEGATIVE NEWS - APPROACHES .pptx
COMMUNICATING NEGATIVE NEWS - APPROACHES .pptx
 
The basics of sentences session 3pptx.pptx
The basics of sentences session 3pptx.pptxThe basics of sentences session 3pptx.pptx
The basics of sentences session 3pptx.pptx
 
Fostering Friendships - Enhancing Social Bonds in the Classroom
Fostering Friendships - Enhancing Social Bonds  in the ClassroomFostering Friendships - Enhancing Social Bonds  in the Classroom
Fostering Friendships - Enhancing Social Bonds in the Classroom
 
REMIFENTANIL: An Ultra short acting opioid.pptx
REMIFENTANIL: An Ultra short acting opioid.pptxREMIFENTANIL: An Ultra short acting opioid.pptx
REMIFENTANIL: An Ultra short acting opioid.pptx
 
Holdier Curriculum Vitae (April 2024).pdf
Holdier Curriculum Vitae (April 2024).pdfHoldier Curriculum Vitae (April 2024).pdf
Holdier Curriculum Vitae (April 2024).pdf
 
SOC 101 Demonstration of Learning Presentation
SOC 101 Demonstration of Learning PresentationSOC 101 Demonstration of Learning Presentation
SOC 101 Demonstration of Learning Presentation
 
Single or Multiple melodic lines structure
Single or Multiple melodic lines structureSingle or Multiple melodic lines structure
Single or Multiple melodic lines structure
 
On_Translating_a_Tamil_Poem_by_A_K_Ramanujan.pptx
On_Translating_a_Tamil_Poem_by_A_K_Ramanujan.pptxOn_Translating_a_Tamil_Poem_by_A_K_Ramanujan.pptx
On_Translating_a_Tamil_Poem_by_A_K_Ramanujan.pptx
 
Sensory_Experience_and_Emotional_Resonance_in_Gabriel_Okaras_The_Piano_and_Th...
Sensory_Experience_and_Emotional_Resonance_in_Gabriel_Okaras_The_Piano_and_Th...Sensory_Experience_and_Emotional_Resonance_in_Gabriel_Okaras_The_Piano_and_Th...
Sensory_Experience_and_Emotional_Resonance_in_Gabriel_Okaras_The_Piano_and_Th...
 
Kodo Millet PPT made by Ghanshyam bairwa college of Agriculture kumher bhara...
Kodo Millet  PPT made by Ghanshyam bairwa college of Agriculture kumher bhara...Kodo Millet  PPT made by Ghanshyam bairwa college of Agriculture kumher bhara...
Kodo Millet PPT made by Ghanshyam bairwa college of Agriculture kumher bhara...
 
HMCS Max Bernays Pre-Deployment Brief (May 2024).pptx
HMCS Max Bernays Pre-Deployment Brief (May 2024).pptxHMCS Max Bernays Pre-Deployment Brief (May 2024).pptx
HMCS Max Bernays Pre-Deployment Brief (May 2024).pptx
 
How to Add New Custom Addons Path in Odoo 17
How to Add New Custom Addons Path in Odoo 17How to Add New Custom Addons Path in Odoo 17
How to Add New Custom Addons Path in Odoo 17
 
Wellbeing inclusion and digital dystopias.pptx
Wellbeing inclusion and digital dystopias.pptxWellbeing inclusion and digital dystopias.pptx
Wellbeing inclusion and digital dystopias.pptx
 
Plant propagation: Sexual and Asexual propapagation.pptx
Plant propagation: Sexual and Asexual propapagation.pptxPlant propagation: Sexual and Asexual propapagation.pptx
Plant propagation: Sexual and Asexual propapagation.pptx
 
Application orientated numerical on hev.ppt
Application orientated numerical on hev.pptApplication orientated numerical on hev.ppt
Application orientated numerical on hev.ppt
 

Indian culture nd tradition

  • 1.
  • 2.
  • 3.
  • 4. INTRODUCTION The culture of India is the way of living of the people of India. India's languages, religions, dance, music, architecture, food, and customs differ from place to place within the country. The Indian culture, often labeled as an amalgamation of several cultures, spans across the Indian subcontinent and has been influenced by a history that is several millennia old. Many elements of India's diverse cultures, such as Indian religions, yoga and Indian cuisine, have had a profound impact across the world.
  • 5. India is the birthplace of Hinduism, Buddhism, Jainism and Sikh ism, collectively known as Indian religions. Indian religions are a major form of world religions. India is one of the most religiously diverse nations in the world, with some of the most deeply religious societies and cultures. Religion plays a central and definitive role in the life of many of its people.
  • 7. India has 22 official languages – 15 of which are Indo-European. Sanskrit has had a profound impact on the languages and literature of India. Hindi is the most spoken language in India, followed by Bengali, Telugu, Marathi, Tamil and Urdu. In contemporary Indian literature, there are two major literary awards; these are the Sahitya Akademi Fellowship and the Jnanpith Award. Eight Jnanpith awards have been awarded in Kannada, six in Hindi, five in Bengali, four in Oriya and Malayalam, three each in Marathi, Gujarati, Urduand Telugu and two each in Assamese, and Tamil.
  • 8.  Indian cuisine is diverse, ranging from very spicy to very mild, varying with seasons in each region. Indian food is as diverse as India. Indian cuisines use numerous ingredients, deploy a wide range of food preparation styles, cooking techniques and culinary presentation. From salads to sauces, from vegetarian to meat, from spices to sensuous, from breads to desserts.
  • 10.  For centuries, arranged marriages have been the tradition in Indian society. Even today, the majority of Indians have their marriages planned by their parents and other respected family- members. In most marriages the bride's family provide a dowry to the bridegroom.
  • 11.  India, being a multi-cultural and multi-religious society, celebrates holidays and festivals of various religions. The three national holidays in India, the Independence Day, the Republic Day and the Gandhi Jayanti, are celebrated with zeal and enthusiasm across India. Regional fairs are also common and festive in India. For example, Pushkar fair is one of the world's largest markets.
  • 12.  The Rāmāyaṇa and the Mahabharata are the oldest preserved and well-known epics of India. The Ramayana consists of 24,000 verses in seven books (kāṇḍas) and 500 cantos (sargas), and tells the story of Rama (an incarnation or Avatar of the Hindu preserver-god Vishnu), whose wife Sita is abducted by the demon king of Lanka, Ravana. Mahabharata text date to 400 BC and is estimated to have reached its final form by the early Gupta period (c. 4th century AD).
  • 13.  The first sculptures in India date back to the Indus Valley civilization, where stone and bronze figures have been discovered. Later, as Hinduism, Buddhism, and Jainism developed further, India produced some extremely intricate bronzes as well as temple carvings. Some huge shrines, such as the one at Ellora were not constructed by using blocks but carved out of solid rock.
  • 14.  Indian architecture encompasses a multitude of expressions over space and time, constantly absorbing new ideas. The result is an evolving range of architectural production that nonetheless retains a certain amount of continuity across history. Some of its earliest production are found in the Indus Valley Civilization (2600–1900 BC) which is characterized by well planned cities and houses.
  • 15.  Cave paintings from Ajanta, Bagh, Ellora and Sittanavasal and temple paintings testify to a love of naturalism. Most early and medieval art in India is Hindu, Buddhist or Jain. A freshly made colored floor design (Rangoli) is still a common sight outside the doorstep of many (mostly South Indian) Indian homes.
  • 16.  The written history of agriculture in India dates back to the Rigveda, written about 1100 BC. Today, India ranks second worldwide in farm output. Agriculture and allied sectors like forestry and fisheries accounted for 13.7% of the GDP(Gross Domestic Product) in 2013,about 50% of the total workforce.
  • 17.  Traditional clothing in India greatly varies across different parts of the country and is influenced by local culture, geography, climate and rural/urban settings. Popular styles of dress include draped garments such as sari for women and dhoti or lungi or panche for men. Bindi is often an essential part of a Hindu woman's make up. Worn on their forehead, some consider the bindi as an auspicious mark.
  • 18. MADE BY- KRISHNA AGRAWAL CLASS-VIII D