SlideShare une entreprise Scribd logo
1  sur  27
Télécharger pour lire hors ligne
Adult Vaccinations: An Update
Bernard J Dunn School of Pharmacy
Shenandoah University
03/13/2013
Objectives
● Evaluate pneumococcal vaccine Menveo®
● Compare Menveo® with other meningococcal
vaccines
● Provide new Advisory Committee on Immunization
Practices (ACIP) recommendations for vaccinations
Menveo®
● FDA approved 2010 for active immunization against
invasive meningococcal disease caused by Neisseria
meningitidis serogroups: A, C, Y and W-135.
● Initially, Menveo® was only indicated for use for persons
11-55 years old. Coverage expanded in June 2011 to
include children ages 2-10.
● Administered as a single dose IM.
Menveo package insert, 2011
Menveo - Efficacy
Clinical Trial for the safety and efficacy of Menveo in children 2-10 years old
study design
MENVEO in subjects 2-55 years old was assessed by comparing
the serum bactericidal antibody (SBA) responses to immunization
with Menveo®
● Two randomized, multicenter, active controlled clinical studies
comparing the hSBA responses following one dose of Menveo® or
Menactra®.
● Primary endpoint - hSBA seroresponse to each serogroup 28 days after
vaccination. Seroresponse was defined as:
- post vaccination hSBA titer of ≥1:8 for subjects with a baseline hSBA titer of <1:4 OR
at least 4-fold higher than baseline titers for subjects with a pre-vaccination hSBA titer ≥1:4.
Menveo package insert, 2011
Menveo - Efficacy
● Population – (1170) Menveo® and (1161)
Menactra®
● Demographics were similar between the two
groups
Menveo - Efficacy
● Results (28 days after vaccination)
Ages 2-5 (seroresponse in %)
Menveo® was non-inferior to Menactra® for subjects with a
seroresponse for serogroups C (60 vs. 56), W-135 (72 vs. 58) and Y
(66 vs. 45) , but not for serogroup A (72 vs. 77)
Ages 6-10
Menveo® was non-inferior to Menactra® for subjects with a
seroresponse for serogroups C(63 vs. 57), W-135 (57 vs. 44) and Y
(58 vs. 39) , but not for serogroup A (77 vs. 83)
Menveo - Efficacy
Ages 11-18
Menveo® was non-inferior to Menactra in all four serogroups A
(75 vs. 66), C (76 vs. 73), W-135(75-63) and Y(68 vs. 41) for the
proportion of subjects with a seroresponse.
Ages 19-55
Menveo® was non-inferior to Menactra in all four serogroups A
(67 vs. 68), C (68 vs. 60), W-135(50-41) and Y(56 vs. 40) for the
proportion of subjects with a seroresponse.
Menveo® - Safety
Study design
● Ages 2-10: four randomized clinical trials.
● Population - 3181 subjects received Menveo® and 2116 received either Menomune®
or Menactra®.
● 51% male in both populations and mean age was 5.2 years old.
● Safety of a second dose of Menveo administered 2 months following a first dose was
assessed in 351 children ages 2-5 years old.
● Ages 11-55: five randomized trials.
● Population - 5286 subjects received Menveo® , 209 subjects received Menomune®
and 1757 patients Menactra®.
● Average ages on Menveo® were 23.5 years (SD 12.9 years), Menacta® 29.2 years (SD
13.4), Menomune® 14.2 years (sd 1.8 years)
● Subjects were monitored for 7 days following vaccinations, 28 days for adverse
events and serious adverse events 6 months after vaccination.
Menveo
● Results - Adverse reactions
Ages 2-10
Injection site pain(31%), erythema (23%), irritability (18%),
induration (16%), sleepiness (14%), malaise (12%), and
headache (11%)
Ages 11-55
Injection site pain (41%), headache (30%), myalgia (18%),
malaise (16%) and nausea (10%)
These adverse reactions when compared to Menactra
were not significantly different.
Menveo®-pregnancy
● Pregnancy Category B – Animal Studies performed in females rabbits at a dose 20x
the human dose revealed no evidence of impaired fertility or harm to the fetus.
● Among 5065 adolescent and adult women enrolled:
– 43 were found to be pregnant during the 6-month follow-up period after
vaccination.
– 37 pregnancies occurred among 3952 Menveo® recipients
7 spontaneous abortions, no congenital anomalies
– 6 pregnancies occurred among 1113 Menactra® recipients
no spontaneous abortions, one congenital anomaly (hydrocephalus)
● Women who are pregnant or become aware that they are pregnant at the time of
Menveo injection should contact the Novartis Vaccines and Diagnostics Inc.
pregnancy registry at 1-877-311-8972
Menveo® vs Menactra®
Menveo® Menactra®
Pathogen N. meningitidis N. meningitidis
Serotypes A, C, Y, W-135 A, C, Y, W-135
Age 2-55 y/o 9 months – 55 y/o
Cost 5 pack-single dose vials:
$110.72
5 pack-single dose vials:
$112.72
Bottom Line:
●Menveo is non inferior to Menactra in the prevention of serogroups A, C, Y, W-135
caused by N. meningitidis. At this moment, based on cost and its age of approval, I
would not recommend it for the addition to the formulary. More studies on its long-
term safety profile would be beneficial for re-evaluation.
Menveo® vs. Menomune®
Menveo® Menomune®
Pathogen N. meningitidis N. meningitidis
Serotypes A, C, Y, W-135 A, C, Y, W-135
Age 2-55 y/o ≥2 y/o
Cost 5 pack-single dose vials:
$110.72
5 pack-single dose vials:
$112.72
Menhibrix®
● Approved June 2012 for infants and children ages 6
weeks - 18 months, for prevention of invasive
disease caused by Neisseria meningitidis serogroups
C and Y and Haemophilus influenzae type b.
● Administered as four IM doses at 2, 4, 6 and 12
through 15 months of age. The first dose may be
given as early as 6 weeks of age. The fourth dose
may be given as late as 18 months of age.
New vaccines 2013
● Flublok® (influenza vaccine)
● Approved January 2013
● Trivalent influenza vaccine made using an insect virus (baculovirus) expression
system and recombinant DNA technology – does not use the influenza virus or eggs
in its production.
● Indication - active immunization against influenza virus subtypes A and type B
● Flublok® is approved for use in persons 18 through 49 years of age.
Flublok® package insert, 2013
Vaccine recommendation updates
Pneumoccocal Polysaccharide Vaccine
2012
● Individuals 65+ y/o vaccinated with PPSV23 before age 65 years and for whom at least 5 years has
passed since their previous dose should be vaccinated with PPSV.
2013
● Individuals who have received 2 doses of PPSV23 before age 65 years are recommended to receive
PPSV23 at age 65 years, as long as it has been 5 years since the most recent dose.
● Pneumococcal Conjugate Vaccine 13 (PCV13) vaccine – recommended for adults aged 19 years or
older with immunocompromising conditions including chronic renal failure, cerebrospinal fluid
leaks and cochlear implants.
● Individuals not previously vaccinated with PCV13 or PPSV23 should receive a single dose of PCV13
Vaccine recommendations updates
Pneumoccocal Polysaccharide Vaccine
Notes
- Individuals 65 years and older, individuals ages 2-64 with long term
health problems including: heart disease, lung disease, sickle cell disease,
diabetes, alcoholism, cirrhosis, leaks if CSF should get the vaccine.
● Individuals ages 2-64 with immunocopromising conditions e.g. kidney
failure, HIV, organ transplant should also be vaccinated.
● Individuals ages 2-64 who on long term steroids, oncology drugs should
also be vaccinated.
● Adults 19-64 years old who are either smokers or have a history of asthma
Vaccine recommendations updates
Influenza
2012
● Infants 6 months or older can receive trivalent inactivated vaccine (TIV).
● Health care professionals caring for persons in a protected environment should receive TIV.
● Health care professionals younger than 50 y/o may receive either the live attenuated
influenza vaccine or TIV as long as they do not have any contraindications.
2013
● The influenza vaccination footnote (footnote 2) will now use the acronym IIV for inactivate
influenza vaccine.
● The acronym TIV has been dropped for trivalent inactivated vaccine.
● 2013–14 influenza season – LAIV will be available only in a quadrivalent formulation; IIV may
be available in both trivalent and quadrivalent formulations.
Notes
- Pregnant women, children 6 months and older, health care personnel, persons living in a
nursing home, individuals with a weakened immune system or have a long term chronic
illness should be vaccinated.
Vaccine recommendations updates
Tetanus, Diptheria, Pertussis (Tdap)
2012
● Persons who are close contacts of infants younger than 12 months of age e.g.
parents, grandparents, and child care providers and who have not received Tdap
previously are recommended to receive the vaccine.
● ACIP recommends pregnant women to receive the vaccination preferentially after 20
weeks gestation.
● Other adults in close contacts of children younger than 12 months are also advised to
receive a one-time dose of Tdap vaccine.
2013
● Adults aged 65 years or older should receive the vaccine.
● Pregnant women are now recommended to receive the Tdap vaccine with each
pregnancy.
Notes
● Recommended as a booster to the DTaP vaccine in children 11-12 years old.
● Adults 19-64 years old should also receive one dose of Tdap and a booster Td
vaccine every 10 years.
Vaccine recommendation updates
Human Papillomavirus (HPV) vaccine
2012
● While the HPV vaccine is not recommended for health care
employees, they should receive the vaccine if they are in
the specified age group.
● Males 11-12 years or males 13-21 years requiring catch up
vaccination may receive the quadrivalent human
papillomavirus (HPV4) vaccine.
● Males aged 22 to 26 years may also be vaccinated with
HPV4 vaccine.
2013
● No changes
Vaccine recommendation updates
Human Papillomavirus (HPV) vaccine
Notes
Gardasil® is approved for:
- Females ages 9-26 to protect against cervical cancer
and to prevent genital warts
- Males ages 9 - 26 to prevent genital warts
Cervarix® is approved for:
- Females age 10 - 26 to help protect against cervical
cancer
Vaccine recommendations updates
Herpes Zoster vaccination
2012
● Although zoster vaccination is not specifically
recommended for health care employees, they should
receive the vaccine if they are in the recommended age
group.
● The Herpes Zoster vaccine is FDA-approved for use in
persons aged 50 years or older – however ACIP continues
to recommend that vaccination begin at age 60 years.
2013
● Persons ≥ 60 years with or without underlying health
conditions are recommended to receive the Zoster vaccine.
Vaccine recommendations updates
Mumps, Measles, Rubella (MMR) Vaccine
2013
● A health care provider diagnosis of measles, mumps, or rubella is not considered
acceptable evidence of immunity.
● Previously, a provider diagnosis of measles or mumps but not rubella was considered
acceptable evidence of immunity.
Notes
- Children 12-15 months should get the vaccine and a second shot should be
administered when the child is 4-6 years old
- Adults born after 1956 should be vaccinated
Vaccine recommendations updates
Hepatitis A and B
2012
● Hepatitis B vaccination is now recommended for
individuals with diabetes who are ≤60 years or if
over 60 and requires glucose monitoring.
2013
● The hepatitis A vaccination is now recommended
for persons with a history of either injection or
non-injection illicit drug use.
Vaccine recommendations updates
Hepatitis A
Notes
- Recommended for all children 1 year and older, people travelling to Asia, Africa,
South America and the Caribbean
- Also recommended for individuals at higher risk including IV drug users, persons
with chronic liver disease, men who have sex with other men, employees of child
daycare centers, persons living in long term care facilities
- If you have had hepatitis A in the past this vaccination is not required.
Hepatitis B
Notes
- High risk individuals including health care workers, persons on dialysis, people
Vaccines in pregnancy
Recommended
Influenza (Inactivated), Tdap
Contraindicated
Influenza (LAIV), MMR, Varicella, Zoster
● Hepatitis B may be recommended in some circumstances: HIV
risk, treatment for STD, recent or current injection drug use
● Meningococcal and Pneumococcal lack sufficient data for
recommendation during pregnancy
References
1. Novartis Vaccines and Diagnostics, Inc. Menveo® package insert. Cambridge, MA:
2011, January
2. Anon. CDC Vaccine Price List. (http://www.cdc.
gov/vaccines/programs/vfc/awardees/vaccine-management/price-list/index.
html) . Updated 7 March 2013. Accessed 19 March 2013.
3. GlaxoSmithKline Biologicals, Inc. Menhibrix® package insert. Pixensart, Belgium:
2012
4. Anon. Recommended Adult Immunization Schedule: United States, 2012*. Ann
Intern Med. 2012 Feb;156(3):211-217.
5. Anon. Recommended Adult Immunization Schedule: United States, 2013* . Ann.
Internal Med. 2013 Feb;158(3):191-199.
6. Anon. Guidelines for Vaccinating Pregnant Women. (http://www.cdc.
gov/vaccines/pubs/preg-guide.htm#hepa) Updated March 2013. Accessed 19
March 2013.
7. Anon. Protein Science Corp. Flublok® package insert. Meriden, CT:2013, January
Questions

Contenu connexe

Tendances

Infant Formula Contaminated By Enterobacteria
Infant Formula Contaminated By EnterobacteriaInfant Formula Contaminated By Enterobacteria
Infant Formula Contaminated By Enterobacteria
Biblioteca Virtual
 

Tendances (20)

Naco guidelines update 2015
Naco guidelines update 2015Naco guidelines update 2015
Naco guidelines update 2015
 
Vacuna hpv y embarazo, nejm marzo 2017
Vacuna hpv y embarazo, nejm marzo 2017Vacuna hpv y embarazo, nejm marzo 2017
Vacuna hpv y embarazo, nejm marzo 2017
 
Boostrix: An Update on Tdap Vaccine in Pregnancy
Boostrix: An Update on Tdap Vaccine in PregnancyBoostrix: An Update on Tdap Vaccine in Pregnancy
Boostrix: An Update on Tdap Vaccine in Pregnancy
 
Rotavirus vaccines in India - Whats new in 2021
Rotavirus vaccines in India - Whats new in 2021 Rotavirus vaccines in India - Whats new in 2021
Rotavirus vaccines in India - Whats new in 2021
 
Meningococcal vaccination needed in india july 2016
Meningococcal vaccination   needed in india july  2016Meningococcal vaccination   needed in india july  2016
Meningococcal vaccination needed in india july 2016
 
Immunization for INDIAN Adolescents Dr. Jyoti Agarwal Dr. Sharda Jain Dr. J...
Immunization for INDIAN Adolescents  Dr. Jyoti Agarwal Dr. Sharda Jain  Dr. J...Immunization for INDIAN Adolescents  Dr. Jyoti Agarwal Dr. Sharda Jain  Dr. J...
Immunization for INDIAN Adolescents Dr. Jyoti Agarwal Dr. Sharda Jain Dr. J...
 
14 tlid1074 klein
14 tlid1074 klein14 tlid1074 klein
14 tlid1074 klein
 
Preterm immunisation 2018 - Dr Karthik Nagesh
Preterm immunisation 2018 - Dr Karthik NageshPreterm immunisation 2018 - Dr Karthik Nagesh
Preterm immunisation 2018 - Dr Karthik Nagesh
 
Clinical Guideline on COVID-19 Vaccination for Adolescents
Clinical Guideline on COVID-19 Vaccination for AdolescentsClinical Guideline on COVID-19 Vaccination for Adolescents
Clinical Guideline on COVID-19 Vaccination for Adolescents
 
Delhi gynaecologist forum Guidelines on Immunization for Indian Adolescent...
Delhi gynaecologist forum Guidelines on  Immunization for Indian Adolescent...Delhi gynaecologist forum Guidelines on  Immunization for Indian Adolescent...
Delhi gynaecologist forum Guidelines on Immunization for Indian Adolescent...
 
Infant Formula Contaminated By Enterobacteria
Infant Formula Contaminated By EnterobacteriaInfant Formula Contaminated By Enterobacteria
Infant Formula Contaminated By Enterobacteria
 
Hep a Live & Inactivated vaccines in India
Hep a Live & Inactivated vaccines in IndiaHep a Live & Inactivated vaccines in India
Hep a Live & Inactivated vaccines in India
 
Prevenar e cme june 2020 & FAQs & COVID Clinic Questions
Prevenar e cme june 2020 & FAQs & COVID Clinic QuestionsPrevenar e cme june 2020 & FAQs & COVID Clinic Questions
Prevenar e cme june 2020 & FAQs & COVID Clinic Questions
 
VACCINATION Update (2020) By Dr Rahul Jain & Dr Sharda Jain
VACCINATION Update (2020) By Dr Rahul Jain & Dr Sharda JainVACCINATION Update (2020) By Dr Rahul Jain & Dr Sharda Jain
VACCINATION Update (2020) By Dr Rahul Jain & Dr Sharda Jain
 
Fogsi GCPR on pregnancy with covid 19 version 1
Fogsi GCPR on pregnancy with covid  19 version 1Fogsi GCPR on pregnancy with covid  19 version 1
Fogsi GCPR on pregnancy with covid 19 version 1
 
Vaccination and pregnancy
Vaccination and pregnancyVaccination and pregnancy
Vaccination and pregnancy
 
Preterm infants
Preterm infantsPreterm infants
Preterm infants
 
ppt on Tdap vaccination by Dr. Alka Mukherjee - Mukherjee Hospital
ppt on Tdap vaccination by Dr. Alka Mukherjee - Mukherjee Hospitalppt on Tdap vaccination by Dr. Alka Mukherjee - Mukherjee Hospital
ppt on Tdap vaccination by Dr. Alka Mukherjee - Mukherjee Hospital
 
Choosing a pneumococcal vaccine - wisely.. Prevenar in Indian context
Choosing a pneumococcal vaccine - wisely.. Prevenar in Indian contextChoosing a pneumococcal vaccine - wisely.. Prevenar in Indian context
Choosing a pneumococcal vaccine - wisely.. Prevenar in Indian context
 
Jan 2013 St George's Presentation for midwives
Jan 2013 St George's Presentation for midwivesJan 2013 St George's Presentation for midwives
Jan 2013 St George's Presentation for midwives
 

En vedette

Attitudinal barriers in communication
Attitudinal barriers in communicationAttitudinal barriers in communication
Attitudinal barriers in communication
Maheshwari Jani
 
defining purpose of presentation
defining purpose of presentationdefining purpose of presentation
defining purpose of presentation
Dhanraj Vaghela
 
Body lang and clothes for presentations
Body lang and clothes for presentationsBody lang and clothes for presentations
Body lang and clothes for presentations
Candice Marshall
 

En vedette (20)

10 Powerful Body Language Tips for your next Presentation
10 Powerful Body Language Tips for your next Presentation10 Powerful Body Language Tips for your next Presentation
10 Powerful Body Language Tips for your next Presentation
 
How Google Works
How Google WorksHow Google Works
How Google Works
 
The Search for Meaning in B2B Marketing
The Search for Meaning in B2B MarketingThe Search for Meaning in B2B Marketing
The Search for Meaning in B2B Marketing
 
Making a formal presentation Sesh Sukhdeo
Making a formal presentation Sesh SukhdeoMaking a formal presentation Sesh Sukhdeo
Making a formal presentation Sesh Sukhdeo
 
Barriers in communication
Barriers in communicationBarriers in communication
Barriers in communication
 
Attitudinal barriers in communication
Attitudinal barriers in communicationAttitudinal barriers in communication
Attitudinal barriers in communication
 
How Managers Can Overcome 3 Systemic Barriers to Effective Communication
How Managers Can Overcome 3 Systemic Barriers to Effective CommunicationHow Managers Can Overcome 3 Systemic Barriers to Effective Communication
How Managers Can Overcome 3 Systemic Barriers to Effective Communication
 
BARRIERS OF EFFECTIVE COMMUNICATION
BARRIERS OF EFFECTIVE COMMUNICATIONBARRIERS OF EFFECTIVE COMMUNICATION
BARRIERS OF EFFECTIVE COMMUNICATION
 
defining purpose of presentation
defining purpose of presentationdefining purpose of presentation
defining purpose of presentation
 
Body lang and clothes for presentations
Body lang and clothes for presentationsBody lang and clothes for presentations
Body lang and clothes for presentations
 
Types of communication
Types of communication Types of communication
Types of communication
 
Effective presentation skills
Effective presentation skillsEffective presentation skills
Effective presentation skills
 
10 Tips for Making Beautiful Slideshow Presentations by www.visuali.se
10 Tips for Making Beautiful Slideshow Presentations by www.visuali.se10 Tips for Making Beautiful Slideshow Presentations by www.visuali.se
10 Tips for Making Beautiful Slideshow Presentations by www.visuali.se
 
The Quick And Dirty Guide To Creating Blog Posts That Your Audience Craves
The Quick And Dirty Guide To Creating Blog Posts That Your Audience CravesThe Quick And Dirty Guide To Creating Blog Posts That Your Audience Craves
The Quick And Dirty Guide To Creating Blog Posts That Your Audience Craves
 
Presentation on formal vs informal communication
Presentation on formal vs informal communication Presentation on formal vs informal communication
Presentation on formal vs informal communication
 
How to format powerpoint presentation slides
How to format powerpoint presentation slidesHow to format powerpoint presentation slides
How to format powerpoint presentation slides
 
Types of communication presentation
Types of communication presentationTypes of communication presentation
Types of communication presentation
 
How to create a basic power point presentation
How to create a basic power point presentationHow to create a basic power point presentation
How to create a basic power point presentation
 
20 Tweetable Quotes to Inspire Marketing & Design Creative Genius
20 Tweetable Quotes to Inspire Marketing & Design Creative Genius20 Tweetable Quotes to Inspire Marketing & Design Creative Genius
20 Tweetable Quotes to Inspire Marketing & Design Creative Genius
 
Presentation on 4 p's
Presentation on 4 p'sPresentation on 4 p's
Presentation on 4 p's
 

Similaire à Student formal presentation

Dr Swati Rajagopal_ ADULT VACCINATION.pptx
Dr Swati Rajagopal_ ADULT VACCINATION.pptxDr Swati Rajagopal_ ADULT VACCINATION.pptx
Dr Swati Rajagopal_ ADULT VACCINATION.pptx
VandanaVats8
 
finalnewervaccinesakhileshppt-210521062533(3)(1).pptx
finalnewervaccinesakhileshppt-210521062533(3)(1).pptxfinalnewervaccinesakhileshppt-210521062533(3)(1).pptx
finalnewervaccinesakhileshppt-210521062533(3)(1).pptx
jyothi132223
 

Similaire à Student formal presentation (20)

Pediatric immunization (part 4/4)
Pediatric immunization (part 4/4)Pediatric immunization (part 4/4)
Pediatric immunization (part 4/4)
 
Vaccination in women from adolescence to menopause
Vaccination in women from adolescence to menopauseVaccination in women from adolescence to menopause
Vaccination in women from adolescence to menopause
 
Vaccinations along all age groups in India
Vaccinations along all age groups in IndiaVaccinations along all age groups in India
Vaccinations along all age groups in India
 
Pediatric immunization (part 3/4)
Pediatric immunization (part 3/4)Pediatric immunization (part 3/4)
Pediatric immunization (part 3/4)
 
Preventive medicine
Preventive medicinePreventive medicine
Preventive medicine
 
Adultvaccinationy 121010201616-phpapp02
Adultvaccinationy 121010201616-phpapp02Adultvaccinationy 121010201616-phpapp02
Adultvaccinationy 121010201616-phpapp02
 
Adult vaccination
Adult vaccinationAdult vaccination
Adult vaccination
 
Dr Swati Rajagopal_ ADULT VACCINATION.pptx
Dr Swati Rajagopal_ ADULT VACCINATION.pptxDr Swati Rajagopal_ ADULT VACCINATION.pptx
Dr Swati Rajagopal_ ADULT VACCINATION.pptx
 
D.G.F. Guidelines on Immunization for Indian Adolescents Girls
D.G.F. Guidelines on  Immunization for  Indian Adolescents Girls D.G.F. Guidelines on  Immunization for  Indian Adolescents Girls
D.G.F. Guidelines on Immunization for Indian Adolescents Girls
 
NEWER VACCINE PPT.ppt
NEWER VACCINE PPT.pptNEWER VACCINE PPT.ppt
NEWER VACCINE PPT.ppt
 
LAIV in India - Should we use it? Sep 2014
LAIV in India - Should we use it? Sep 2014LAIV in India - Should we use it? Sep 2014
LAIV in India - Should we use it? Sep 2014
 
WHAT IS CERVICAL CANCER EXPERTS STAND ON ONE DOSE RECOMMENDATION FOR HPV VA...
WHAT IS CERVICAL CANCER EXPERTS STAND ON ONE DOSE RECOMMENDATION FOR HPV VA...WHAT IS CERVICAL CANCER EXPERTS STAND ON ONE DOSE RECOMMENDATION FOR HPV VA...
WHAT IS CERVICAL CANCER EXPERTS STAND ON ONE DOSE RECOMMENDATION FOR HPV VA...
 
finalnewervaccinesakhileshppt-210521062533(3)(1).pptx
finalnewervaccinesakhileshppt-210521062533(3)(1).pptxfinalnewervaccinesakhileshppt-210521062533(3)(1).pptx
finalnewervaccinesakhileshppt-210521062533(3)(1).pptx
 
DR JRK ADULT IMMUNIZATION programme.pptx
DR JRK ADULT IMMUNIZATION programme.pptxDR JRK ADULT IMMUNIZATION programme.pptx
DR JRK ADULT IMMUNIZATION programme.pptx
 
New Value of Vaccines
New Value of VaccinesNew Value of Vaccines
New Value of Vaccines
 
Recommended Immunization Schedules For Children And Adolescents,
Recommended Immunization Schedules For Children And Adolescents,Recommended Immunization Schedules For Children And Adolescents,
Recommended Immunization Schedules For Children And Adolescents,
 
Adult schedule-bw
Adult schedule-bwAdult schedule-bw
Adult schedule-bw
 
Perinatal HIV- Prevention of Parent to child transmission (PPTCT)
Perinatal HIV- Prevention of Parent to child transmission (PPTCT)Perinatal HIV- Prevention of Parent to child transmission (PPTCT)
Perinatal HIV- Prevention of Parent to child transmission (PPTCT)
 
Vacunas 2017
Vacunas 2017Vacunas 2017
Vacunas 2017
 
Adult immunisation schedule
Adult immunisation scheduleAdult immunisation schedule
Adult immunisation schedule
 

Dernier

Call Girl in Indore 8827247818 {LowPrice} ❤️ (ahana) Indore Call Girls * UPA...
Call Girl in Indore 8827247818 {LowPrice} ❤️ (ahana) Indore Call Girls  * UPA...Call Girl in Indore 8827247818 {LowPrice} ❤️ (ahana) Indore Call Girls  * UPA...
Call Girl in Indore 8827247818 {LowPrice} ❤️ (ahana) Indore Call Girls * UPA...
mahaiklolahd
 
Call Girls in Gagan Vihar (delhi) call me [🔝 9953056974 🔝] escort service 24X7
Call Girls in Gagan Vihar (delhi) call me [🔝  9953056974 🔝] escort service 24X7Call Girls in Gagan Vihar (delhi) call me [🔝  9953056974 🔝] escort service 24X7
Call Girls in Gagan Vihar (delhi) call me [🔝 9953056974 🔝] escort service 24X7
9953056974 Low Rate Call Girls In Saket, Delhi NCR
 
Call Girl In Pune 👉 Just CALL ME: 9352988975 💋 Call Out Call Both With High p...
Call Girl In Pune 👉 Just CALL ME: 9352988975 💋 Call Out Call Both With High p...Call Girl In Pune 👉 Just CALL ME: 9352988975 💋 Call Out Call Both With High p...
Call Girl In Pune 👉 Just CALL ME: 9352988975 💋 Call Out Call Both With High p...
chetankumar9855
 
Russian Call Girls Lucknow Just Call 👉👉7877925207 Top Class Call Girl Service...
Russian Call Girls Lucknow Just Call 👉👉7877925207 Top Class Call Girl Service...Russian Call Girls Lucknow Just Call 👉👉7877925207 Top Class Call Girl Service...
Russian Call Girls Lucknow Just Call 👉👉7877925207 Top Class Call Girl Service...
adilkhan87451
 

Dernier (20)

Saket * Call Girls in Delhi - Phone 9711199012 Escorts Service at 6k to 50k a...
Saket * Call Girls in Delhi - Phone 9711199012 Escorts Service at 6k to 50k a...Saket * Call Girls in Delhi - Phone 9711199012 Escorts Service at 6k to 50k a...
Saket * Call Girls in Delhi - Phone 9711199012 Escorts Service at 6k to 50k a...
 
Call Girl in Indore 8827247818 {LowPrice} ❤️ (ahana) Indore Call Girls * UPA...
Call Girl in Indore 8827247818 {LowPrice} ❤️ (ahana) Indore Call Girls  * UPA...Call Girl in Indore 8827247818 {LowPrice} ❤️ (ahana) Indore Call Girls  * UPA...
Call Girl in Indore 8827247818 {LowPrice} ❤️ (ahana) Indore Call Girls * UPA...
 
Call Girls Hyderabad Just Call 8250077686 Top Class Call Girl Service Available
Call Girls Hyderabad Just Call 8250077686 Top Class Call Girl Service AvailableCall Girls Hyderabad Just Call 8250077686 Top Class Call Girl Service Available
Call Girls Hyderabad Just Call 8250077686 Top Class Call Girl Service Available
 
Call Girls Vasai Virar Just Call 9630942363 Top Class Call Girl Service Avail...
Call Girls Vasai Virar Just Call 9630942363 Top Class Call Girl Service Avail...Call Girls Vasai Virar Just Call 9630942363 Top Class Call Girl Service Avail...
Call Girls Vasai Virar Just Call 9630942363 Top Class Call Girl Service Avail...
 
Call Girls Hosur Just Call 9630942363 Top Class Call Girl Service Available
Call Girls Hosur Just Call 9630942363 Top Class Call Girl Service AvailableCall Girls Hosur Just Call 9630942363 Top Class Call Girl Service Available
Call Girls Hosur Just Call 9630942363 Top Class Call Girl Service Available
 
Call Girls in Gagan Vihar (delhi) call me [🔝 9953056974 🔝] escort service 24X7
Call Girls in Gagan Vihar (delhi) call me [🔝  9953056974 🔝] escort service 24X7Call Girls in Gagan Vihar (delhi) call me [🔝  9953056974 🔝] escort service 24X7
Call Girls in Gagan Vihar (delhi) call me [🔝 9953056974 🔝] escort service 24X7
 
Coimbatore Call Girls in Thudiyalur : 7427069034 High Profile Model Escorts |...
Coimbatore Call Girls in Thudiyalur : 7427069034 High Profile Model Escorts |...Coimbatore Call Girls in Thudiyalur : 7427069034 High Profile Model Escorts |...
Coimbatore Call Girls in Thudiyalur : 7427069034 High Profile Model Escorts |...
 
Low Rate Call Girls Bangalore {7304373326} ❤️VVIP NISHA Call Girls in Bangalo...
Low Rate Call Girls Bangalore {7304373326} ❤️VVIP NISHA Call Girls in Bangalo...Low Rate Call Girls Bangalore {7304373326} ❤️VVIP NISHA Call Girls in Bangalo...
Low Rate Call Girls Bangalore {7304373326} ❤️VVIP NISHA Call Girls in Bangalo...
 
Call Girls Service Jaipur {9521753030 } ❤️VVIP BHAWNA Call Girl in Jaipur Raj...
Call Girls Service Jaipur {9521753030 } ❤️VVIP BHAWNA Call Girl in Jaipur Raj...Call Girls Service Jaipur {9521753030 } ❤️VVIP BHAWNA Call Girl in Jaipur Raj...
Call Girls Service Jaipur {9521753030 } ❤️VVIP BHAWNA Call Girl in Jaipur Raj...
 
Premium Call Girls In Jaipur {8445551418} ❤️VVIP SEEMA Call Girl in Jaipur Ra...
Premium Call Girls In Jaipur {8445551418} ❤️VVIP SEEMA Call Girl in Jaipur Ra...Premium Call Girls In Jaipur {8445551418} ❤️VVIP SEEMA Call Girl in Jaipur Ra...
Premium Call Girls In Jaipur {8445551418} ❤️VVIP SEEMA Call Girl in Jaipur Ra...
 
9630942363 Genuine Call Girls In Ahmedabad Gujarat Call Girls Service
9630942363 Genuine Call Girls In Ahmedabad Gujarat Call Girls Service9630942363 Genuine Call Girls In Ahmedabad Gujarat Call Girls Service
9630942363 Genuine Call Girls In Ahmedabad Gujarat Call Girls Service
 
Independent Call Girls In Jaipur { 8445551418 } ✔ ANIKA MEHTA ✔ Get High Prof...
Independent Call Girls In Jaipur { 8445551418 } ✔ ANIKA MEHTA ✔ Get High Prof...Independent Call Girls In Jaipur { 8445551418 } ✔ ANIKA MEHTA ✔ Get High Prof...
Independent Call Girls In Jaipur { 8445551418 } ✔ ANIKA MEHTA ✔ Get High Prof...
 
Trichy Call Girls Book Now 9630942363 Top Class Trichy Escort Service Available
Trichy Call Girls Book Now 9630942363 Top Class Trichy Escort Service AvailableTrichy Call Girls Book Now 9630942363 Top Class Trichy Escort Service Available
Trichy Call Girls Book Now 9630942363 Top Class Trichy Escort Service Available
 
Independent Call Girls Service Mohali Sector 116 | 6367187148 | Call Girl Ser...
Independent Call Girls Service Mohali Sector 116 | 6367187148 | Call Girl Ser...Independent Call Girls Service Mohali Sector 116 | 6367187148 | Call Girl Ser...
Independent Call Girls Service Mohali Sector 116 | 6367187148 | Call Girl Ser...
 
Call Girls Ahmedabad Just Call 9630942363 Top Class Call Girl Service Available
Call Girls Ahmedabad Just Call 9630942363 Top Class Call Girl Service AvailableCall Girls Ahmedabad Just Call 9630942363 Top Class Call Girl Service Available
Call Girls Ahmedabad Just Call 9630942363 Top Class Call Girl Service Available
 
Call Girl In Pune 👉 Just CALL ME: 9352988975 💋 Call Out Call Both With High p...
Call Girl In Pune 👉 Just CALL ME: 9352988975 💋 Call Out Call Both With High p...Call Girl In Pune 👉 Just CALL ME: 9352988975 💋 Call Out Call Both With High p...
Call Girl In Pune 👉 Just CALL ME: 9352988975 💋 Call Out Call Both With High p...
 
Night 7k to 12k Chennai City Center Call Girls 👉👉 7427069034⭐⭐ 100% Genuine E...
Night 7k to 12k Chennai City Center Call Girls 👉👉 7427069034⭐⭐ 100% Genuine E...Night 7k to 12k Chennai City Center Call Girls 👉👉 7427069034⭐⭐ 100% Genuine E...
Night 7k to 12k Chennai City Center Call Girls 👉👉 7427069034⭐⭐ 100% Genuine E...
 
Russian Call Girls Lucknow Just Call 👉👉7877925207 Top Class Call Girl Service...
Russian Call Girls Lucknow Just Call 👉👉7877925207 Top Class Call Girl Service...Russian Call Girls Lucknow Just Call 👉👉7877925207 Top Class Call Girl Service...
Russian Call Girls Lucknow Just Call 👉👉7877925207 Top Class Call Girl Service...
 
The Most Attractive Hyderabad Call Girls Kothapet 𖠋 9332606886 𖠋 Will You Mis...
The Most Attractive Hyderabad Call Girls Kothapet 𖠋 9332606886 𖠋 Will You Mis...The Most Attractive Hyderabad Call Girls Kothapet 𖠋 9332606886 𖠋 Will You Mis...
The Most Attractive Hyderabad Call Girls Kothapet 𖠋 9332606886 𖠋 Will You Mis...
 
Call Girls Service Jaipur {8445551418} ❤️VVIP BHAWNA Call Girl in Jaipur Raja...
Call Girls Service Jaipur {8445551418} ❤️VVIP BHAWNA Call Girl in Jaipur Raja...Call Girls Service Jaipur {8445551418} ❤️VVIP BHAWNA Call Girl in Jaipur Raja...
Call Girls Service Jaipur {8445551418} ❤️VVIP BHAWNA Call Girl in Jaipur Raja...
 

Student formal presentation

  • 1. Adult Vaccinations: An Update Bernard J Dunn School of Pharmacy Shenandoah University 03/13/2013
  • 2. Objectives ● Evaluate pneumococcal vaccine Menveo® ● Compare Menveo® with other meningococcal vaccines ● Provide new Advisory Committee on Immunization Practices (ACIP) recommendations for vaccinations
  • 3. Menveo® ● FDA approved 2010 for active immunization against invasive meningococcal disease caused by Neisseria meningitidis serogroups: A, C, Y and W-135. ● Initially, Menveo® was only indicated for use for persons 11-55 years old. Coverage expanded in June 2011 to include children ages 2-10. ● Administered as a single dose IM. Menveo package insert, 2011
  • 4. Menveo - Efficacy Clinical Trial for the safety and efficacy of Menveo in children 2-10 years old study design MENVEO in subjects 2-55 years old was assessed by comparing the serum bactericidal antibody (SBA) responses to immunization with Menveo® ● Two randomized, multicenter, active controlled clinical studies comparing the hSBA responses following one dose of Menveo® or Menactra®. ● Primary endpoint - hSBA seroresponse to each serogroup 28 days after vaccination. Seroresponse was defined as: - post vaccination hSBA titer of ≥1:8 for subjects with a baseline hSBA titer of <1:4 OR at least 4-fold higher than baseline titers for subjects with a pre-vaccination hSBA titer ≥1:4. Menveo package insert, 2011
  • 5. Menveo - Efficacy ● Population – (1170) Menveo® and (1161) Menactra® ● Demographics were similar between the two groups
  • 6. Menveo - Efficacy ● Results (28 days after vaccination) Ages 2-5 (seroresponse in %) Menveo® was non-inferior to Menactra® for subjects with a seroresponse for serogroups C (60 vs. 56), W-135 (72 vs. 58) and Y (66 vs. 45) , but not for serogroup A (72 vs. 77) Ages 6-10 Menveo® was non-inferior to Menactra® for subjects with a seroresponse for serogroups C(63 vs. 57), W-135 (57 vs. 44) and Y (58 vs. 39) , but not for serogroup A (77 vs. 83)
  • 7. Menveo - Efficacy Ages 11-18 Menveo® was non-inferior to Menactra in all four serogroups A (75 vs. 66), C (76 vs. 73), W-135(75-63) and Y(68 vs. 41) for the proportion of subjects with a seroresponse. Ages 19-55 Menveo® was non-inferior to Menactra in all four serogroups A (67 vs. 68), C (68 vs. 60), W-135(50-41) and Y(56 vs. 40) for the proportion of subjects with a seroresponse.
  • 8. Menveo® - Safety Study design ● Ages 2-10: four randomized clinical trials. ● Population - 3181 subjects received Menveo® and 2116 received either Menomune® or Menactra®. ● 51% male in both populations and mean age was 5.2 years old. ● Safety of a second dose of Menveo administered 2 months following a first dose was assessed in 351 children ages 2-5 years old. ● Ages 11-55: five randomized trials. ● Population - 5286 subjects received Menveo® , 209 subjects received Menomune® and 1757 patients Menactra®. ● Average ages on Menveo® were 23.5 years (SD 12.9 years), Menacta® 29.2 years (SD 13.4), Menomune® 14.2 years (sd 1.8 years) ● Subjects were monitored for 7 days following vaccinations, 28 days for adverse events and serious adverse events 6 months after vaccination.
  • 9. Menveo ● Results - Adverse reactions Ages 2-10 Injection site pain(31%), erythema (23%), irritability (18%), induration (16%), sleepiness (14%), malaise (12%), and headache (11%) Ages 11-55 Injection site pain (41%), headache (30%), myalgia (18%), malaise (16%) and nausea (10%) These adverse reactions when compared to Menactra were not significantly different.
  • 10. Menveo®-pregnancy ● Pregnancy Category B – Animal Studies performed in females rabbits at a dose 20x the human dose revealed no evidence of impaired fertility or harm to the fetus. ● Among 5065 adolescent and adult women enrolled: – 43 were found to be pregnant during the 6-month follow-up period after vaccination. – 37 pregnancies occurred among 3952 Menveo® recipients 7 spontaneous abortions, no congenital anomalies – 6 pregnancies occurred among 1113 Menactra® recipients no spontaneous abortions, one congenital anomaly (hydrocephalus) ● Women who are pregnant or become aware that they are pregnant at the time of Menveo injection should contact the Novartis Vaccines and Diagnostics Inc. pregnancy registry at 1-877-311-8972
  • 11. Menveo® vs Menactra® Menveo® Menactra® Pathogen N. meningitidis N. meningitidis Serotypes A, C, Y, W-135 A, C, Y, W-135 Age 2-55 y/o 9 months – 55 y/o Cost 5 pack-single dose vials: $110.72 5 pack-single dose vials: $112.72 Bottom Line: ●Menveo is non inferior to Menactra in the prevention of serogroups A, C, Y, W-135 caused by N. meningitidis. At this moment, based on cost and its age of approval, I would not recommend it for the addition to the formulary. More studies on its long- term safety profile would be beneficial for re-evaluation.
  • 12. Menveo® vs. Menomune® Menveo® Menomune® Pathogen N. meningitidis N. meningitidis Serotypes A, C, Y, W-135 A, C, Y, W-135 Age 2-55 y/o ≥2 y/o Cost 5 pack-single dose vials: $110.72 5 pack-single dose vials: $112.72
  • 13. Menhibrix® ● Approved June 2012 for infants and children ages 6 weeks - 18 months, for prevention of invasive disease caused by Neisseria meningitidis serogroups C and Y and Haemophilus influenzae type b. ● Administered as four IM doses at 2, 4, 6 and 12 through 15 months of age. The first dose may be given as early as 6 weeks of age. The fourth dose may be given as late as 18 months of age.
  • 14. New vaccines 2013 ● Flublok® (influenza vaccine) ● Approved January 2013 ● Trivalent influenza vaccine made using an insect virus (baculovirus) expression system and recombinant DNA technology – does not use the influenza virus or eggs in its production. ● Indication - active immunization against influenza virus subtypes A and type B ● Flublok® is approved for use in persons 18 through 49 years of age. Flublok® package insert, 2013
  • 15. Vaccine recommendation updates Pneumoccocal Polysaccharide Vaccine 2012 ● Individuals 65+ y/o vaccinated with PPSV23 before age 65 years and for whom at least 5 years has passed since their previous dose should be vaccinated with PPSV. 2013 ● Individuals who have received 2 doses of PPSV23 before age 65 years are recommended to receive PPSV23 at age 65 years, as long as it has been 5 years since the most recent dose. ● Pneumococcal Conjugate Vaccine 13 (PCV13) vaccine – recommended for adults aged 19 years or older with immunocompromising conditions including chronic renal failure, cerebrospinal fluid leaks and cochlear implants. ● Individuals not previously vaccinated with PCV13 or PPSV23 should receive a single dose of PCV13
  • 16. Vaccine recommendations updates Pneumoccocal Polysaccharide Vaccine Notes - Individuals 65 years and older, individuals ages 2-64 with long term health problems including: heart disease, lung disease, sickle cell disease, diabetes, alcoholism, cirrhosis, leaks if CSF should get the vaccine. ● Individuals ages 2-64 with immunocopromising conditions e.g. kidney failure, HIV, organ transplant should also be vaccinated. ● Individuals ages 2-64 who on long term steroids, oncology drugs should also be vaccinated. ● Adults 19-64 years old who are either smokers or have a history of asthma
  • 17. Vaccine recommendations updates Influenza 2012 ● Infants 6 months or older can receive trivalent inactivated vaccine (TIV). ● Health care professionals caring for persons in a protected environment should receive TIV. ● Health care professionals younger than 50 y/o may receive either the live attenuated influenza vaccine or TIV as long as they do not have any contraindications. 2013 ● The influenza vaccination footnote (footnote 2) will now use the acronym IIV for inactivate influenza vaccine. ● The acronym TIV has been dropped for trivalent inactivated vaccine. ● 2013–14 influenza season – LAIV will be available only in a quadrivalent formulation; IIV may be available in both trivalent and quadrivalent formulations. Notes - Pregnant women, children 6 months and older, health care personnel, persons living in a nursing home, individuals with a weakened immune system or have a long term chronic illness should be vaccinated.
  • 18. Vaccine recommendations updates Tetanus, Diptheria, Pertussis (Tdap) 2012 ● Persons who are close contacts of infants younger than 12 months of age e.g. parents, grandparents, and child care providers and who have not received Tdap previously are recommended to receive the vaccine. ● ACIP recommends pregnant women to receive the vaccination preferentially after 20 weeks gestation. ● Other adults in close contacts of children younger than 12 months are also advised to receive a one-time dose of Tdap vaccine. 2013 ● Adults aged 65 years or older should receive the vaccine. ● Pregnant women are now recommended to receive the Tdap vaccine with each pregnancy. Notes ● Recommended as a booster to the DTaP vaccine in children 11-12 years old. ● Adults 19-64 years old should also receive one dose of Tdap and a booster Td vaccine every 10 years.
  • 19. Vaccine recommendation updates Human Papillomavirus (HPV) vaccine 2012 ● While the HPV vaccine is not recommended for health care employees, they should receive the vaccine if they are in the specified age group. ● Males 11-12 years or males 13-21 years requiring catch up vaccination may receive the quadrivalent human papillomavirus (HPV4) vaccine. ● Males aged 22 to 26 years may also be vaccinated with HPV4 vaccine. 2013 ● No changes
  • 20. Vaccine recommendation updates Human Papillomavirus (HPV) vaccine Notes Gardasil® is approved for: - Females ages 9-26 to protect against cervical cancer and to prevent genital warts - Males ages 9 - 26 to prevent genital warts Cervarix® is approved for: - Females age 10 - 26 to help protect against cervical cancer
  • 21. Vaccine recommendations updates Herpes Zoster vaccination 2012 ● Although zoster vaccination is not specifically recommended for health care employees, they should receive the vaccine if they are in the recommended age group. ● The Herpes Zoster vaccine is FDA-approved for use in persons aged 50 years or older – however ACIP continues to recommend that vaccination begin at age 60 years. 2013 ● Persons ≥ 60 years with or without underlying health conditions are recommended to receive the Zoster vaccine.
  • 22. Vaccine recommendations updates Mumps, Measles, Rubella (MMR) Vaccine 2013 ● A health care provider diagnosis of measles, mumps, or rubella is not considered acceptable evidence of immunity. ● Previously, a provider diagnosis of measles or mumps but not rubella was considered acceptable evidence of immunity. Notes - Children 12-15 months should get the vaccine and a second shot should be administered when the child is 4-6 years old - Adults born after 1956 should be vaccinated
  • 23. Vaccine recommendations updates Hepatitis A and B 2012 ● Hepatitis B vaccination is now recommended for individuals with diabetes who are ≤60 years or if over 60 and requires glucose monitoring. 2013 ● The hepatitis A vaccination is now recommended for persons with a history of either injection or non-injection illicit drug use.
  • 24. Vaccine recommendations updates Hepatitis A Notes - Recommended for all children 1 year and older, people travelling to Asia, Africa, South America and the Caribbean - Also recommended for individuals at higher risk including IV drug users, persons with chronic liver disease, men who have sex with other men, employees of child daycare centers, persons living in long term care facilities - If you have had hepatitis A in the past this vaccination is not required. Hepatitis B Notes - High risk individuals including health care workers, persons on dialysis, people
  • 25. Vaccines in pregnancy Recommended Influenza (Inactivated), Tdap Contraindicated Influenza (LAIV), MMR, Varicella, Zoster ● Hepatitis B may be recommended in some circumstances: HIV risk, treatment for STD, recent or current injection drug use ● Meningococcal and Pneumococcal lack sufficient data for recommendation during pregnancy
  • 26. References 1. Novartis Vaccines and Diagnostics, Inc. Menveo® package insert. Cambridge, MA: 2011, January 2. Anon. CDC Vaccine Price List. (http://www.cdc. gov/vaccines/programs/vfc/awardees/vaccine-management/price-list/index. html) . Updated 7 March 2013. Accessed 19 March 2013. 3. GlaxoSmithKline Biologicals, Inc. Menhibrix® package insert. Pixensart, Belgium: 2012 4. Anon. Recommended Adult Immunization Schedule: United States, 2012*. Ann Intern Med. 2012 Feb;156(3):211-217. 5. Anon. Recommended Adult Immunization Schedule: United States, 2013* . Ann. Internal Med. 2013 Feb;158(3):191-199. 6. Anon. Guidelines for Vaccinating Pregnant Women. (http://www.cdc. gov/vaccines/pubs/preg-guide.htm#hepa) Updated March 2013. Accessed 19 March 2013. 7. Anon. Protein Science Corp. Flublok® package insert. Meriden, CT:2013, January