SlideShare une entreprise Scribd logo
1  sur  23
Drug Research Software
Solutions
Proposal
for
XXXX
Accommodator Consultancy Services,
Lucknow
Dr Vibhor Mahendru
Ankur Khanna
Accommodator Consultancy Services
Lucknow
Drug Research: Common Challenges
 EXPENSIVE! - Drug research is expensive. A new drug takes
around 15 years and $1.2b from concept to market.
 LOW SUCCESS RATE! - The success ratio is extremely low
with most candidate molecules being abandoned midway. Two
out of three submissions with regulatory authorities result in
failures.
 LOW GROWTH RATE! - The typical growth rate has reduced
from 13% to 5%. Limited resources.
 DUPLICATION OF EFFORT! - Companies often end up
duplicating research effort as they fail to determine if similar
research is taking place somewhere else.
 OMICS EMIT UNMANAGEABLE DATA! - Newer technologies
have come in, that deal at gene and cell level. Resulting data is
Voluminous, in Various formats and gets piled up at a blistering
pace. Drug research faces challenges in leveraging these
technologies in a timely, effective , efficient and optimum
manner.
Accommodator Consultancy Services
Lucknow
Our Offerings in IT in Life Sciences
 TEXT MINING SOLUTIONS
 DATA WAREHOUSE SOLUTIONS
 DATA MINING SOLUTIONS
 DATABASE DEVELOPMENT SOLUTIONS
 BIG DATA ANALYTICS
 CANCER SOLUTIONS
Accommodator Consultancy Services
Lucknow
TEXT MINING SOLUTIONS
Philosophy – Researchers to be able to find new information found in the
various scientific reports and papers published around the world and then
absorb that information into their ongoing work and give direction to their
work by gathering and analyzing trends.
Areas Covered:
 Patents
 Research papers
 Publications
 Specialized web sites such as Pubchem, Pubmed covering millions of articles
 Social media sites such as Facebook, Twitter, Instagram, blogging forums etc,
 Internal collection of documents and information.
Deliverable: A set of programs that would automatically run and prepare
Reports and documents with relevant summarized and detailed information
downloaded from above mentioned sources based on input keywords and
events.
Accommodator Consultancy Services
Lucknow
WHY PATENT MINING
 Patent information of Novel bioactive chemical structures related to drug
discovery exceed those in journals by at least five-fold.
 Patents encompass academic, as well as commercial, global med. chem.
output.
 Targets, assays, mechanisms of action, disease descriptions and in-vivo
data.
 ~ 70% of data initially patent-only, some never disclosed elswhere.
 Include synthetic descriptions and other useful enabling information.
 Precede journal or meeting reports by ~ 1.5 to 5 years.
 Can be complementary to papers (e.g. larger SAR matrix).
 Intersect with papers at chemistry, target, disease, author and citation levels
 IP exploitable for Neglected Tropical Disease research becoming ”open”.
Accommodator Consultancy Services
Lucknow
PATENT MINING @ NOVARTIS
Accommodator Consultancy Services
Lucknow
MAQALPWLLLWMGAGVLPAHGTQHGIRLPLRSGLGG
APLGLRLPRETDEEPEEPGRRGSFVEMVDNLRGKSGQ
GYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHR
YYQRQLSSTYRDLRKGVYVPYTQGKWEGELGTDLVSI
PHGPNVTVRANIAAITESDKFFINGSNWEGILGLAYAEI
ARPDDSLEPFFDSLVKQTHVPNLFSLQLCGAGFPLNQSE
VLASVGGSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIV
RVEINGQDLKMDCKEYNYDKSIVDSGTTNLRLPKKVF
EAAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWN
IFPVISLYLMGEVTNQSFRITILPQQYLRPVEDVATSQD
DCYKFAISQSSTGTVMGAVIMEGFYVVFDRARKRIGFA
VSACHVHDEFRTAAVEGPFVTLDMEDCGYNIPQTDEST
LMTIAYVMAAICALFMLPLCLMVCQWRCLRCLRQQH
DDFADDISLLK
Document Assay Result Compound Target
DATA MINING SOLUTIONS
 Definition - Data Mining is an interdisciplinary subfield of computer science that
discovers patterns in large data sets involving methods at the intersection of
artificial intelligence, machine learning, statistics, and database systems.
 Philosophy – The overall goal of the data mining process is to extract
information from a data set and transform it into an understandable structure for
further use.
 Areas Covered:
 Virtual HTS and HCS Data
 Predictive Toxicology
 Life sciences and health related issues trending on social media
 FDA datasets
 Micro-biomes
 Chemo-genomics
 Predicting and preventing diseases through gene analysis
 Both big an small molecules
 Deliverable: Converting raw data into actionable information after detecting
patterns and trends, and applying a number of verified algorithms.
 Benefits: Improves prediction of early stage drug safety testing. Data mining
(as opposed to conventional statistical analysis) can uncover patterns and
relationships in large data volumes that are completely unexpected. Patterns
can be used to extrapolate and predict.
Accommodator Consultancy Services
Lucknow
DATA MINING PROCESS & ALGORIGHTMS
Accommodator Consultancy Services
Lucknow
DATA MINING CASE STUDIES
@ Roche:
Used DM techniques to set up models for the diagnostic of diabetes high risk group
to analyze existing samples sets (including Diabetes II patients and healthy subjects),
to identify the factors (age, sex, race, height, weight, BMI value, ADA value) that may
cause Diabetes II, and predict the probability of the subjects developing Diabetes II in
the next 7 and half years, in order to take preventive measures a traditional statistical
methods are not as accurate as DM methods.
@ GSK:
Data Mining Human Gut Microbiota for therapeutic targets. This could lead to a
systems-level understanding of the global physiology of the host–microbiota
superorganism in health and disease. Such knowledge will provide a platform for the
identification and development of new therapeutic strategies for chronic diseases
possibly involving microbial as well as human-host targets that improve upon existing
probiotics, prebiotics or antibiotics
used text analytics to analyze public discussion boards on BabyCenter.com and
WhattoExpect.com, to learn what factors motivate parents to either go ahead or delay
vaccinating their children for diseases like measles and mumps.
Data mining was used to identify unrecognized drug interaction (pravastatin and
paroxetine) that suggested raising blood glucose level manifold. However this would
need a careful crystallization of the problem statement by experts to make the
exercise useful.
Accommodator Consultancy Services
Lucknow
DATA MINING CASE STUDIES
@ Bayer:
GI adverse effect of short term Aspirin use. Meta analysis of AE comparison with
similar drugs for mktg. & drug improvement.
@ Pfizer:
Uses mining to determine if certain AE’s are being reported with greater frequency
than expected.
large-scale semantic Web-based data mining and network methods to seek to
uncover previously undiscovered historical links between chemical compounds,
drugs, biological pathways, targets, genes and diseases.
By using big data to bring together genomic data, clinical trials and EMR data,
Pfizer was able to develop precise drug ‘Xalkori’ which proves very effective for
around 5% of patients suffering from cancer who suffer mutation of their ALK gene.
Through data mining, this sub section of population was identified which had a
healthy lifestyle, yet got affected by cancer.
It funded a study that would use genomic data mining to identify antigens in NTS
(non-typhoidal salmonella) that may be used as targets for vaccine development.
@ Johnson & Johnson:
Has built an open source data management system called Transmart. The idea is
to combine genomic data sets, from internal and external sources, using the
platform's data standards and processing capabilities. This facilitates data mining
which provides immense opportunities.
Accommodator Consultancy Services
Lucknow
DATA MINING CASE STUDIES
@ Novartis:
In HTS, used Ontology Based Pattern Identification (OPI) algorithm to predict
patters by which they were able to find out 1500 scaffold families with significant
structure-HTS activity profile relationships.
@ Astra Zeneca
It uses data-mining tools to identify plausible preclinical Gastro Intestinal effects
that may be associated with nausea and that could be of potential use in its
prediction. A total of 86 marketed drugs were used in this analysis, and the main
outcome was a confirmation that nausogenic and non-nausogenic drugs can be
clearly separated based on their preclinical GI observations. .
Accommodator Consultancy Services
Lucknow
CHEMOGENOMICS DATA MINING
Chemogenomics is rapidly emerging as a way of helping discover new disease therapies and
uncovering new uses for existing drugs.
There are large structure activity databases set up by pharmaceutical companies and
commercial vendors. These databases can be mined to derive insights into common properties or
structural features among ligands linked to common features of the receptors to which they bind.
These insights can then used for the rational compilation of screening sets or the knowledge-based
synthesis of chemical libraries to accelerate lead finding.
Can be used to reposition drugs and find new applications for existing
drugs/molecules/compounds.
Four Canadian government research funding agencies will spend around US$6.7 million to
create a cloud computing facility and data mining tools that will enable researchers to access and
use data from the International Cancer Genome Consortium.
DM could lead to a systems-level understanding of the global physiology of the host–microbiota
superorganism in health and disease. Such knowledge will provide a platform for the identification
and development of new therapeutic strategies for chronic diseases possibly involving microbial as
well as human-host targets that improve upon existing probiotics, prebiotics or antibiotics
We can collect or organize known GPCR and non GPCR ligands and mining models can be
trained based on such properties. New compounds can automatically be classified as ligand or non
ligand based compound.
Design and knowledge based synthesis of chemical libraries targeting subfamily of purinergic
GPCR . Chemical scoffolds can be synthesized.
Accommodator Consultancy Services
Lucknow
DATA WAREHOUSE SOLUTIONS
Definition – Central repository created by integrating data from disparate
sources, with past and current data for both operational and strategic decision
making and senior management reporting such as annual comparisons of budget
per scientist.
Goal – to enable users appropriate access to a homogenized, comprehensive
and consistent view of the organization, supporting forecasting and decision-
making processes at the enterprise level..
Areas Covered:
 Bioinformatics research
 Finance
 HR
 Marketing
 Disease Management etc
Deliverable: Central repository of useful and actionable data integrated from
multiple departments and sources and available to end users for operational and
strategic decision making in an efficient and effective manner.
Benefits: Better use of internal resources, Reduction in critical time path for
statistical analysis. Standard exchange of data with CRO’s, partners and
regulatory agencies. Cross trial analysis and leveraged use of historical data.
Globalization and knowledge sharing. Facilitates open source drug development.
Compliance with regulatory authorities.
Accommodator Consultancy Services
Lucknow
DWH DESIGN
Accommodator Consultancy Services
Lucknow
DWH @ NOVARTIS
Prominent DWH – FDA’s Janus, Johnson and Johnson, Pfizer,
Novartis’ Avalon, GSK and Roche
DWH Use Cases:
Accommodator Consultancy Services
Lucknow
DWH USE CASES
Novartis:
Tell me everything about a given structure
 Collect comprehensive data of corporate interest in a single place.
 Data grouped by chemical structure.
 Standardized data dictionary to describe data.
 Chemical structure conventions are unified.
 Computed descriptors would be available
Given a substructure give me useful calculated descriptors.
 Assays physical properties and calculated descriptors are represented uniformly.
 Will support changing row model between batch, compound and bioactive.
Find all compounds in stock with some publicly known activity.
 Integrate structured in house data with external data.
 Set the row model by active substance.
 Pre defined task based query to automate this kind of query.
FDA Janus:
Janus creates an integrated data platform for most commercial tools for review, analysis and reporting.
It reduces overall cost of information gathering and submissions, development process as well as review and analysis
of information.
It provides a common data model that is based on the SDTM standard to represent four classes of clinical data
submitted to regulatory agencies: tabulation datasets, patient profiles, listings, etc.
It provides central access to standardized data, and provides common data views across collaborative partners.
It supports cross-trial analyses for data mining and helps detect clinical trends and address clinical hypotheses, and
performs more advanced, robust analysis. This enables the ability to contrast and compare data from multiple clinical
trials to help improve efficacy and safety.
It facilitates a more efficient review process and ability to locate and query data more easily through automated
processes and data standards.
It provides a potentially broader data view for all clinical trials with proper security, de-identified patient data, and
proper agreements in place to share data.Accommodator Consultancy Services
Lucknow
ERP v/s DWH
People confuse between ERP and DWH. They are
different as shown below:
Accommodator Consultancy Services
Lucknow
ERP DWH
 Detailed  Summarized
 Facilitate data entry &
storage
 Facilitate quick analysis
 Used by Operations  Used by Strategists
 End users need to be
trained
 Generalist end users
 No AdHoc reporting  Facilitates ad hoc reports
 ERP for biochemical less
available
 Easily integrates and
stores biochemical data
DATABASE SOLUTIONS
Drug discovery analytics is traditionally performed on
Relational Database Management Systems. However
with new discoveries, it does not remain an optimal
choice. Discoveries require newer technologies.
Commercial RDBMS have kept pace by introducing
newer features (such as column store indexes)
We design the RDBMS to consolidate data from
disparate sources to facilitate analytics. We also convert
existing DBMS systems to leverage newly introduced
features.
We also undertake performance enhancements,
provide additional security and other maintenance
tasks.
Accommodator Consultancy Services
Lucknow
BIG DATA SOLUTIONS
Definition – A collection of data sets so large and complex that it becomes difficult
to process using on-hand database management tools or traditional data processing
applications. The challenges include capture, curation, storage, search, sharing,
transfer, analysis and visualization. The trend to larger data sets is due to the
additional information derivable from analysis of a single large set of related data, as
compared to separate smaller sets with the same total amount of data, allowing
correlations to be found to "spot business trends, determine quality of research,
prevent diseases, link legal citations, combat crime, and determine real-time roadway
traffic conditions.
Philosophy – To handle such huge data generated by Omics, regular computers
are used that are networked/set up in such a way to make it loss proof and leverage
individuals processors to work in synergy and solve bigger problems Companies have
started offering cloud storage for big data and publicly available.
Areas Covered:
 Finding cause of diseases
 Repositioning of drugs
 Prescription of more effective drugs and procedures.
Deliverable - We collect information about possible sources of data for related
research area. We analyze the data for volume variety and velocity. We do a small
pilot prototype of the big data set up using source big data on cloud. We set up
programs to collect and process the data and then try to solve the hypothesis
Accommodator Consultancy Services
Lucknow
BIG DATA SOLUTIONS
Accommodator Consultancy Services
Lucknow
Use Case 1: Researchers found that previously undetected mutations in a single
gene (called LMX1B) triggered focal segmental glomerulosclerosis (FSGS), a
disease that scars the kidneys’ filtering system. This was possible after genome data
was collected and compared for healthy and diseased individuals.
Use Case 2: Big data approach already has predicted the efficacy of drug
repurposing for treating colitis — a form of inflammatory bowel disease — small-cell
lung cancer and other conditions, according to Scott Saywell, vice president,
corporate development, NuMedii.
Use Case 3: For patients, the use of big data analytics in drug development results
in less trial and error when physicians prescribe drugs. This tighter targeting of
drugs to disease also results in fewer side effects.
According to new draft policy by Dept. of Biotechnology, Govt. of India, genome
based prescription and treatment will be top priority in next few years.
The draft policy envisages converting half of hospitals currently engaged in
treatment of human diseases to that of prediction and prevention of diseases using
genomic tools.
It also aims to provide all available genetic screening tests to general public at
affordable prices.
Genome data processing and analysis has been possible by Big Data as genome
(and other omics technologies) for just one individual results in data that tops 80
story building when translated on a paper.
Cancer Solutions
Accommodator Consultancy Services
Lucknow
• We offer collaborate with CDRI and ITRI for providing cancer patients data
for further research.
• We do research on National Cancer Data Repository providing consultancy
on cancer drugs and assisting in cancer research with a goal of
personalized cancer solutions.
• Any other assistance you would need on this subject.
Value that Accommodator
Consultancy would add
Accommodator Consultancy Services
Lucknow
 We have vast experience in data analysis, text and data mining
and dealing in technologies compatible with biochemical
substances having delivered successful projects throughout the
world. We will take the IT and statistics worries away from you
so you can concentrate on pure research.
 We have the skills to be able to work with large volumes of data
and Big Data (Hadoop) source systems.
 Vast experience in developing, using and configuring different
kinds of bioinformatics software.
 Team consists of chemist, data warehouse and data mining
professional and senior cancer surgeon.
 We firmly believe in providing great value in our service/product
offering.
Questions/Comments?
Accommodator Consultancy Services
Lucknow
In the interest of keeping material short, only a simple summary
has been provided. Please do not hesitate to ask any
questions/clarification for further details.
Our contact details:
Ankur Khanna: Director Technical
945 166 8432
Dr Vibhor Mahendru: Director Business Development
800 536 5132
THANK YOU

Contenu connexe

Tendances

Palantir Company Preso
Palantir Company PresoPalantir Company Preso
Palantir Company PresoJacob Flom
 
Oracle Technology Vision 2021
Oracle Technology Vision 2021Oracle Technology Vision 2021
Oracle Technology Vision 2021accenture
 
Accenture Global Operations for R&D
Accenture Global Operations for R&DAccenture Global Operations for R&D
Accenture Global Operations for R&Daccenture
 
The Digital Thread for Life Sciences | Accenture
The Digital Thread for Life Sciences | AccentureThe Digital Thread for Life Sciences | Accenture
The Digital Thread for Life Sciences | Accentureaccenture
 
Nossas Soluções
Nossas SoluçõesNossas Soluções
Nossas Soluçõesaccenture
 
Research and Development Solutions | Accenture
Research and Development Solutions | AccentureResearch and Development Solutions | Accenture
Research and Development Solutions | Accentureaccenture
 
Accenture Life Sciences | INTIENT Network
Accenture Life Sciences | INTIENT NetworkAccenture Life Sciences | INTIENT Network
Accenture Life Sciences | INTIENT Networkaccenture
 
Accenture Regulatory Services
Accenture Regulatory ServicesAccenture Regulatory Services
Accenture Regulatory Servicesaccenture
 
Modernizing Our Data Platform
Modernizing Our Data PlatformModernizing Our Data Platform
Modernizing Our Data Platformaccenture
 
ASTRAZENECA. Knowledge Graphs Powering a Fast-moving Global Life Sciences Org...
ASTRAZENECA. Knowledge Graphs Powering a Fast-moving Global Life Sciences Org...ASTRAZENECA. Knowledge Graphs Powering a Fast-moving Global Life Sciences Org...
ASTRAZENECA. Knowledge Graphs Powering a Fast-moving Global Life Sciences Org...Neo4j
 
Digital transformation in the Pharma Industry
Digital transformation in the Pharma Industry Digital transformation in the Pharma Industry
Digital transformation in the Pharma Industry Maria Alexandri
 
New Science: Pharma's new growth machine
New Science: Pharma's new growth machineNew Science: Pharma's new growth machine
New Science: Pharma's new growth machineaccenture
 
The Data Lifecycle - EUDAT Summer School (Yann Le Franc)
The Data Lifecycle - EUDAT Summer School (Yann Le Franc)The Data Lifecycle - EUDAT Summer School (Yann Le Franc)
The Data Lifecycle - EUDAT Summer School (Yann Le Franc)EUDAT
 
How AstraZeneca is Applying AI, Imaging & Data Analytics (AI-Driven Drug Deve...
How AstraZeneca is Applying AI, Imaging & Data Analytics (AI-Driven Drug Deve...How AstraZeneca is Applying AI, Imaging & Data Analytics (AI-Driven Drug Deve...
How AstraZeneca is Applying AI, Imaging & Data Analytics (AI-Driven Drug Deve...Nick Brown
 
Edward segel interactive_storytelling
Edward segel interactive_storytellingEdward segel interactive_storytelling
Edward segel interactive_storytellingKristen Chan
 
Pivot to the Patient
Pivot to the PatientPivot to the Patient
Pivot to the Patientaccenture
 
Liferay for Healthcare IT Solutions
Liferay for Healthcare IT Solutions  Liferay for Healthcare IT Solutions
Liferay for Healthcare IT Solutions AIMDek Technologies
 
Unplanned analytics-led transformation
Unplanned analytics-led transformationUnplanned analytics-led transformation
Unplanned analytics-led transformationaccenture
 

Tendances (20)

Palantir Company Preso
Palantir Company PresoPalantir Company Preso
Palantir Company Preso
 
Oracle Technology Vision 2021
Oracle Technology Vision 2021Oracle Technology Vision 2021
Oracle Technology Vision 2021
 
Accenture Global Operations for R&D
Accenture Global Operations for R&DAccenture Global Operations for R&D
Accenture Global Operations for R&D
 
The Digital Thread for Life Sciences | Accenture
The Digital Thread for Life Sciences | AccentureThe Digital Thread for Life Sciences | Accenture
The Digital Thread for Life Sciences | Accenture
 
Nossas Soluções
Nossas SoluçõesNossas Soluções
Nossas Soluções
 
Research and Development Solutions | Accenture
Research and Development Solutions | AccentureResearch and Development Solutions | Accenture
Research and Development Solutions | Accenture
 
Accenture Life Sciences | INTIENT Network
Accenture Life Sciences | INTIENT NetworkAccenture Life Sciences | INTIENT Network
Accenture Life Sciences | INTIENT Network
 
Accenture Regulatory Services
Accenture Regulatory ServicesAccenture Regulatory Services
Accenture Regulatory Services
 
Modernizing Our Data Platform
Modernizing Our Data PlatformModernizing Our Data Platform
Modernizing Our Data Platform
 
ASTRAZENECA. Knowledge Graphs Powering a Fast-moving Global Life Sciences Org...
ASTRAZENECA. Knowledge Graphs Powering a Fast-moving Global Life Sciences Org...ASTRAZENECA. Knowledge Graphs Powering a Fast-moving Global Life Sciences Org...
ASTRAZENECA. Knowledge Graphs Powering a Fast-moving Global Life Sciences Org...
 
IBM Cloud pak for data brochure
IBM Cloud pak for data   brochureIBM Cloud pak for data   brochure
IBM Cloud pak for data brochure
 
Digital transformation in the Pharma Industry
Digital transformation in the Pharma Industry Digital transformation in the Pharma Industry
Digital transformation in the Pharma Industry
 
New Science: Pharma's new growth machine
New Science: Pharma's new growth machineNew Science: Pharma's new growth machine
New Science: Pharma's new growth machine
 
The Data Lifecycle - EUDAT Summer School (Yann Le Franc)
The Data Lifecycle - EUDAT Summer School (Yann Le Franc)The Data Lifecycle - EUDAT Summer School (Yann Le Franc)
The Data Lifecycle - EUDAT Summer School (Yann Le Franc)
 
How AstraZeneca is Applying AI, Imaging & Data Analytics (AI-Driven Drug Deve...
How AstraZeneca is Applying AI, Imaging & Data Analytics (AI-Driven Drug Deve...How AstraZeneca is Applying AI, Imaging & Data Analytics (AI-Driven Drug Deve...
How AstraZeneca is Applying AI, Imaging & Data Analytics (AI-Driven Drug Deve...
 
Big data
Big dataBig data
Big data
 
Edward segel interactive_storytelling
Edward segel interactive_storytellingEdward segel interactive_storytelling
Edward segel interactive_storytelling
 
Pivot to the Patient
Pivot to the PatientPivot to the Patient
Pivot to the Patient
 
Liferay for Healthcare IT Solutions
Liferay for Healthcare IT Solutions  Liferay for Healthcare IT Solutions
Liferay for Healthcare IT Solutions
 
Unplanned analytics-led transformation
Unplanned analytics-led transformationUnplanned analytics-led transformation
Unplanned analytics-led transformation
 

En vedette

Improving pharmaceutical marketing using big data solutions
Improving pharmaceutical marketing using big data solutionsImproving pharmaceutical marketing using big data solutions
Improving pharmaceutical marketing using big data solutionsPaul Grant
 
Data mining (DM) in the pharmaceutical industry
Data mining (DM) in the pharmaceutical industryData mining (DM) in the pharmaceutical industry
Data mining (DM) in the pharmaceutical industrylurdhu agnes
 
New Pharma Market Reality - Predictive Analytics is the Solution
New Pharma Market Reality - Predictive Analytics is the SolutionNew Pharma Market Reality - Predictive Analytics is the Solution
New Pharma Market Reality - Predictive Analytics is the SolutionDr. Sandeep Juneja
 
Application of BI in pharmaceutical industry
Application of BI in pharmaceutical industryApplication of BI in pharmaceutical industry
Application of BI in pharmaceutical industryBiBoard.Org
 
Big Data in Healthcare Made Simple: Where It Stands Today and Where It’s Going
Big Data in Healthcare Made Simple: Where It Stands Today and Where It’s GoingBig Data in Healthcare Made Simple: Where It Stands Today and Where It’s Going
Big Data in Healthcare Made Simple: Where It Stands Today and Where It’s GoingHealth Catalyst
 
Case Study: Big Data Analytics
Case Study: Big Data AnalyticsCase Study: Big Data Analytics
Case Study: Big Data AnalyticsAbhinav Das
 
Pistoia Alliance Debates: SEND, the CDISC Standard for Exchange of Nonclinica...
Pistoia Alliance Debates: SEND, the CDISC Standard for Exchange of Nonclinica...Pistoia Alliance Debates: SEND, the CDISC Standard for Exchange of Nonclinica...
Pistoia Alliance Debates: SEND, the CDISC Standard for Exchange of Nonclinica...Pistoia Alliance
 
March 2009 DIA Janus Update
March 2009 DIA Janus UpdateMarch 2009 DIA Janus Update
March 2009 DIA Janus Updateolivaa
 
Big Data Challenges for Real-Time Personalized Medicine
Big Data Challenges for Real-Time Personalized MedicineBig Data Challenges for Real-Time Personalized Medicine
Big Data Challenges for Real-Time Personalized MedicineSAP Technology
 
The CDISC-HL7 Project
The CDISC-HL7 ProjectThe CDISC-HL7 Project
The CDISC-HL7 Projectolivaa
 
Big Data 101 - A guide for pharmaceutical brand managers
Big Data 101 - A guide for pharmaceutical brand managersBig Data 101 - A guide for pharmaceutical brand managers
Big Data 101 - A guide for pharmaceutical brand managersDale Butler
 
Surveys, a company’s best friend: the 5 ways they can have an influence on yo...
Surveys, a company’s best friend: the 5 ways they can have an influence on yo...Surveys, a company’s best friend: the 5 ways they can have an influence on yo...
Surveys, a company’s best friend: the 5 ways they can have an influence on yo...Survmetrics
 
3 Techniques to Increase Conversions for Your SaaS Business
3 Techniques to Increase Conversions for Your SaaS Business3 Techniques to Increase Conversions for Your SaaS Business
3 Techniques to Increase Conversions for Your SaaS BusinessKissmetrics on SlideShare
 
Sales Representative In New Wave Marketing 2009
Sales Representative In New Wave Marketing 2009Sales Representative In New Wave Marketing 2009
Sales Representative In New Wave Marketing 2009Moch Kurniawan
 
An overview of clinical data repository
An overview of clinical data repositoryAn overview of clinical data repository
An overview of clinical data repositoryNetrah Laxminarayanan
 
CDISC Electronic Submission to FDA
CDISC Electronic Submission to FDACDISC Electronic Submission to FDA
CDISC Electronic Submission to FDAKevin Lee
 

En vedette (17)

Analytics in Pharmaceutical Industry
Analytics in Pharmaceutical IndustryAnalytics in Pharmaceutical Industry
Analytics in Pharmaceutical Industry
 
Improving pharmaceutical marketing using big data solutions
Improving pharmaceutical marketing using big data solutionsImproving pharmaceutical marketing using big data solutions
Improving pharmaceutical marketing using big data solutions
 
Data mining (DM) in the pharmaceutical industry
Data mining (DM) in the pharmaceutical industryData mining (DM) in the pharmaceutical industry
Data mining (DM) in the pharmaceutical industry
 
New Pharma Market Reality - Predictive Analytics is the Solution
New Pharma Market Reality - Predictive Analytics is the SolutionNew Pharma Market Reality - Predictive Analytics is the Solution
New Pharma Market Reality - Predictive Analytics is the Solution
 
Application of BI in pharmaceutical industry
Application of BI in pharmaceutical industryApplication of BI in pharmaceutical industry
Application of BI in pharmaceutical industry
 
Big Data in Healthcare Made Simple: Where It Stands Today and Where It’s Going
Big Data in Healthcare Made Simple: Where It Stands Today and Where It’s GoingBig Data in Healthcare Made Simple: Where It Stands Today and Where It’s Going
Big Data in Healthcare Made Simple: Where It Stands Today and Where It’s Going
 
Case Study: Big Data Analytics
Case Study: Big Data AnalyticsCase Study: Big Data Analytics
Case Study: Big Data Analytics
 
Pistoia Alliance Debates: SEND, the CDISC Standard for Exchange of Nonclinica...
Pistoia Alliance Debates: SEND, the CDISC Standard for Exchange of Nonclinica...Pistoia Alliance Debates: SEND, the CDISC Standard for Exchange of Nonclinica...
Pistoia Alliance Debates: SEND, the CDISC Standard for Exchange of Nonclinica...
 
March 2009 DIA Janus Update
March 2009 DIA Janus UpdateMarch 2009 DIA Janus Update
March 2009 DIA Janus Update
 
Big Data Challenges for Real-Time Personalized Medicine
Big Data Challenges for Real-Time Personalized MedicineBig Data Challenges for Real-Time Personalized Medicine
Big Data Challenges for Real-Time Personalized Medicine
 
The CDISC-HL7 Project
The CDISC-HL7 ProjectThe CDISC-HL7 Project
The CDISC-HL7 Project
 
Big Data 101 - A guide for pharmaceutical brand managers
Big Data 101 - A guide for pharmaceutical brand managersBig Data 101 - A guide for pharmaceutical brand managers
Big Data 101 - A guide for pharmaceutical brand managers
 
Surveys, a company’s best friend: the 5 ways they can have an influence on yo...
Surveys, a company’s best friend: the 5 ways they can have an influence on yo...Surveys, a company’s best friend: the 5 ways they can have an influence on yo...
Surveys, a company’s best friend: the 5 ways they can have an influence on yo...
 
3 Techniques to Increase Conversions for Your SaaS Business
3 Techniques to Increase Conversions for Your SaaS Business3 Techniques to Increase Conversions for Your SaaS Business
3 Techniques to Increase Conversions for Your SaaS Business
 
Sales Representative In New Wave Marketing 2009
Sales Representative In New Wave Marketing 2009Sales Representative In New Wave Marketing 2009
Sales Representative In New Wave Marketing 2009
 
An overview of clinical data repository
An overview of clinical data repositoryAn overview of clinical data repository
An overview of clinical data repository
 
CDISC Electronic Submission to FDA
CDISC Electronic Submission to FDACDISC Electronic Submission to FDA
CDISC Electronic Submission to FDA
 

Similaire à Data Mining and Big Data Analytics in Pharma

Role of bioinformatics in drug designing
Role of bioinformatics in drug designingRole of bioinformatics in drug designing
Role of bioinformatics in drug designingW Roseybala Devi
 
Wk 5 case 1 designing drug virtually
Wk 5 case 1 designing drug virtually Wk 5 case 1 designing drug virtually
Wk 5 case 1 designing drug virtually dyadelm
 
Case 5.1 - DESIGNING DRUGS VIRTUALLY
Case 5.1 - DESIGNING DRUGS VIRTUALLYCase 5.1 - DESIGNING DRUGS VIRTUALLY
Case 5.1 - DESIGNING DRUGS VIRTUALLYAya Wan Idris
 
Research trends in different pharmaceutical areas.docx
Research trends in different pharmaceutical areas.docxResearch trends in different pharmaceutical areas.docx
Research trends in different pharmaceutical areas.docxImtiajChowdhuryEham
 
Advances in computer aided drug design
Advances in computer aided drug designAdvances in computer aided drug design
Advances in computer aided drug designVikas Soni
 
Discovery on Target 2014 - The Industry's Preeminent Event on Novel Drug Targets
Discovery on Target 2014 - The Industry's Preeminent Event on Novel Drug TargetsDiscovery on Target 2014 - The Industry's Preeminent Event on Novel Drug Targets
Discovery on Target 2014 - The Industry's Preeminent Event on Novel Drug TargetsJaime Hodges
 
Artificial Intelligence in Medicine.pdf
Artificial Intelligence in Medicine.pdfArtificial Intelligence in Medicine.pdf
Artificial Intelligence in Medicine.pdfzeeshan811731
 
Role of bioinformatics of drug designing
Role of bioinformatics of drug designingRole of bioinformatics of drug designing
Role of bioinformatics of drug designingDr NEETHU ASOKAN
 
Nucleic Acid Aptamers for Diagnostics and Therapeutics: Global Markets
Nucleic Acid Aptamers for Diagnostics and Therapeutics: Global MarketsNucleic Acid Aptamers for Diagnostics and Therapeutics: Global Markets
Nucleic Acid Aptamers for Diagnostics and Therapeutics: Global MarketsReportsnReports
 
DOE-NCI Pilots presentation at the Frederick National Laboratory Advisory Com...
DOE-NCI Pilots presentation at the Frederick National Laboratory Advisory Com...DOE-NCI Pilots presentation at the Frederick National Laboratory Advisory Com...
DOE-NCI Pilots presentation at the Frederick National Laboratory Advisory Com...Warren Kibbe
 
Big Data Analytics in the Health Domain
Big Data Analytics in the Health DomainBig Data Analytics in the Health Domain
Big Data Analytics in the Health DomainBigData_Europe
 
5 Cutting-Edge Trends in Molecular Diagnostics
5 Cutting-Edge Trends in Molecular Diagnostics5 Cutting-Edge Trends in Molecular Diagnostics
5 Cutting-Edge Trends in Molecular DiagnosticsBruce Carlson
 
Simplifying semantics for biomedical applications
Simplifying semantics for biomedical applicationsSimplifying semantics for biomedical applications
Simplifying semantics for biomedical applicationsSemantic Web San Diego
 
System for Recommending Drugs Based on Machine Learning Sentiment Analysis of...
System for Recommending Drugs Based on Machine Learning Sentiment Analysis of...System for Recommending Drugs Based on Machine Learning Sentiment Analysis of...
System for Recommending Drugs Based on Machine Learning Sentiment Analysis of...IRJET Journal
 

Similaire à Data Mining and Big Data Analytics in Pharma (20)

Role of bioinformatics in drug designing
Role of bioinformatics in drug designingRole of bioinformatics in drug designing
Role of bioinformatics in drug designing
 
Wk 5 case 1 designing drug virtually
Wk 5 case 1 designing drug virtually Wk 5 case 1 designing drug virtually
Wk 5 case 1 designing drug virtually
 
Case 5.1 - DESIGNING DRUGS VIRTUALLY
Case 5.1 - DESIGNING DRUGS VIRTUALLYCase 5.1 - DESIGNING DRUGS VIRTUALLY
Case 5.1 - DESIGNING DRUGS VIRTUALLY
 
Research trends in different pharmaceutical areas.docx
Research trends in different pharmaceutical areas.docxResearch trends in different pharmaceutical areas.docx
Research trends in different pharmaceutical areas.docx
 
Advances in computer aided drug design
Advances in computer aided drug designAdvances in computer aided drug design
Advances in computer aided drug design
 
Discovery on Target 2014 - The Industry's Preeminent Event on Novel Drug Targets
Discovery on Target 2014 - The Industry's Preeminent Event on Novel Drug TargetsDiscovery on Target 2014 - The Industry's Preeminent Event on Novel Drug Targets
Discovery on Target 2014 - The Industry's Preeminent Event on Novel Drug Targets
 
Artificial Intelligence in Medicine.pdf
Artificial Intelligence in Medicine.pdfArtificial Intelligence in Medicine.pdf
Artificial Intelligence in Medicine.pdf
 
Role of bioinformatics of drug designing
Role of bioinformatics of drug designingRole of bioinformatics of drug designing
Role of bioinformatics of drug designing
 
Meta analysis of molecular property patterns and filtering of public datasets...
Meta analysis of molecular property patterns and filtering of public datasets...Meta analysis of molecular property patterns and filtering of public datasets...
Meta analysis of molecular property patterns and filtering of public datasets...
 
Nucleic Acid Aptamers for Diagnostics and Therapeutics: Global Markets
Nucleic Acid Aptamers for Diagnostics and Therapeutics: Global MarketsNucleic Acid Aptamers for Diagnostics and Therapeutics: Global Markets
Nucleic Acid Aptamers for Diagnostics and Therapeutics: Global Markets
 
MURI Summer
MURI SummerMURI Summer
MURI Summer
 
DOE-NCI Pilots presentation at the Frederick National Laboratory Advisory Com...
DOE-NCI Pilots presentation at the Frederick National Laboratory Advisory Com...DOE-NCI Pilots presentation at the Frederick National Laboratory Advisory Com...
DOE-NCI Pilots presentation at the Frederick National Laboratory Advisory Com...
 
Journal
JournalJournal
Journal
 
Big Data Analytics in the Health Domain
Big Data Analytics in the Health DomainBig Data Analytics in the Health Domain
Big Data Analytics in the Health Domain
 
5 Cutting-Edge Trends in Molecular Diagnostics
5 Cutting-Edge Trends in Molecular Diagnostics5 Cutting-Edge Trends in Molecular Diagnostics
5 Cutting-Edge Trends in Molecular Diagnostics
 
new drug discovery studies
new drug discovery studiesnew drug discovery studies
new drug discovery studies
 
Simplifying semantics for biomedical applications
Simplifying semantics for biomedical applicationsSimplifying semantics for biomedical applications
Simplifying semantics for biomedical applications
 
When pharmaceutical companies publish large datasets an abundance of riches o...
When pharmaceutical companies publish large datasets an abundance of riches o...When pharmaceutical companies publish large datasets an abundance of riches o...
When pharmaceutical companies publish large datasets an abundance of riches o...
 
System for Recommending Drugs Based on Machine Learning Sentiment Analysis of...
System for Recommending Drugs Based on Machine Learning Sentiment Analysis of...System for Recommending Drugs Based on Machine Learning Sentiment Analysis of...
System for Recommending Drugs Based on Machine Learning Sentiment Analysis of...
 
Cadd
CaddCadd
Cadd
 

Dernier

➥🔝 7737669865 🔝▻ mahisagar Call-girls in Women Seeking Men 🔝mahisagar🔝 Esc...
➥🔝 7737669865 🔝▻ mahisagar Call-girls in Women Seeking Men  🔝mahisagar🔝   Esc...➥🔝 7737669865 🔝▻ mahisagar Call-girls in Women Seeking Men  🔝mahisagar🔝   Esc...
➥🔝 7737669865 🔝▻ mahisagar Call-girls in Women Seeking Men 🔝mahisagar🔝 Esc...amitlee9823
 
VIP Model Call Girls Hinjewadi ( Pune ) Call ON 8005736733 Starting From 5K t...
VIP Model Call Girls Hinjewadi ( Pune ) Call ON 8005736733 Starting From 5K t...VIP Model Call Girls Hinjewadi ( Pune ) Call ON 8005736733 Starting From 5K t...
VIP Model Call Girls Hinjewadi ( Pune ) Call ON 8005736733 Starting From 5K t...SUHANI PANDEY
 
Call Girls Indiranagar Just Call 👗 9155563397 👗 Top Class Call Girl Service B...
Call Girls Indiranagar Just Call 👗 9155563397 👗 Top Class Call Girl Service B...Call Girls Indiranagar Just Call 👗 9155563397 👗 Top Class Call Girl Service B...
Call Girls Indiranagar Just Call 👗 9155563397 👗 Top Class Call Girl Service B...only4webmaster01
 
April 2024 - Crypto Market Report's Analysis
April 2024 - Crypto Market Report's AnalysisApril 2024 - Crypto Market Report's Analysis
April 2024 - Crypto Market Report's Analysismanisha194592
 
➥🔝 7737669865 🔝▻ Thrissur Call-girls in Women Seeking Men 🔝Thrissur🔝 Escor...
➥🔝 7737669865 🔝▻ Thrissur Call-girls in Women Seeking Men  🔝Thrissur🔝   Escor...➥🔝 7737669865 🔝▻ Thrissur Call-girls in Women Seeking Men  🔝Thrissur🔝   Escor...
➥🔝 7737669865 🔝▻ Thrissur Call-girls in Women Seeking Men 🔝Thrissur🔝 Escor...amitlee9823
 
Call Girls in Sarai Kale Khan Delhi 💯 Call Us 🔝9205541914 🔝( Delhi) Escorts S...
Call Girls in Sarai Kale Khan Delhi 💯 Call Us 🔝9205541914 🔝( Delhi) Escorts S...Call Girls in Sarai Kale Khan Delhi 💯 Call Us 🔝9205541914 🔝( Delhi) Escorts S...
Call Girls in Sarai Kale Khan Delhi 💯 Call Us 🔝9205541914 🔝( Delhi) Escorts S...Delhi Call girls
 
hybrid Seed Production In Chilli & Capsicum.pptx
hybrid Seed Production In Chilli & Capsicum.pptxhybrid Seed Production In Chilli & Capsicum.pptx
hybrid Seed Production In Chilli & Capsicum.pptx9to5mart
 
Junnasandra Call Girls: 🍓 7737669865 🍓 High Profile Model Escorts | Bangalore...
Junnasandra Call Girls: 🍓 7737669865 🍓 High Profile Model Escorts | Bangalore...Junnasandra Call Girls: 🍓 7737669865 🍓 High Profile Model Escorts | Bangalore...
Junnasandra Call Girls: 🍓 7737669865 🍓 High Profile Model Escorts | Bangalore...amitlee9823
 
➥🔝 7737669865 🔝▻ malwa Call-girls in Women Seeking Men 🔝malwa🔝 Escorts Ser...
➥🔝 7737669865 🔝▻ malwa Call-girls in Women Seeking Men  🔝malwa🔝   Escorts Ser...➥🔝 7737669865 🔝▻ malwa Call-girls in Women Seeking Men  🔝malwa🔝   Escorts Ser...
➥🔝 7737669865 🔝▻ malwa Call-girls in Women Seeking Men 🔝malwa🔝 Escorts Ser...amitlee9823
 
Call Girls Begur Just Call 👗 7737669865 👗 Top Class Call Girl Service Bangalore
Call Girls Begur Just Call 👗 7737669865 👗 Top Class Call Girl Service BangaloreCall Girls Begur Just Call 👗 7737669865 👗 Top Class Call Girl Service Bangalore
Call Girls Begur Just Call 👗 7737669865 👗 Top Class Call Girl Service Bangaloreamitlee9823
 
Call me @ 9892124323 Cheap Rate Call Girls in Vashi with Real Photo 100% Secure
Call me @ 9892124323  Cheap Rate Call Girls in Vashi with Real Photo 100% SecureCall me @ 9892124323  Cheap Rate Call Girls in Vashi with Real Photo 100% Secure
Call me @ 9892124323 Cheap Rate Call Girls in Vashi with Real Photo 100% SecurePooja Nehwal
 
Jual Obat Aborsi Surabaya ( Asli No.1 ) 085657271886 Obat Penggugur Kandungan...
Jual Obat Aborsi Surabaya ( Asli No.1 ) 085657271886 Obat Penggugur Kandungan...Jual Obat Aborsi Surabaya ( Asli No.1 ) 085657271886 Obat Penggugur Kandungan...
Jual Obat Aborsi Surabaya ( Asli No.1 ) 085657271886 Obat Penggugur Kandungan...ZurliaSoop
 
Call Girls In Hsr Layout ☎ 7737669865 🥵 Book Your One night Stand
Call Girls In Hsr Layout ☎ 7737669865 🥵 Book Your One night StandCall Girls In Hsr Layout ☎ 7737669865 🥵 Book Your One night Stand
Call Girls In Hsr Layout ☎ 7737669865 🥵 Book Your One night Standamitlee9823
 
Discover Why Less is More in B2B Research
Discover Why Less is More in B2B ResearchDiscover Why Less is More in B2B Research
Discover Why Less is More in B2B Researchmichael115558
 
Mg Road Call Girls Service: 🍓 7737669865 🍓 High Profile Model Escorts | Banga...
Mg Road Call Girls Service: 🍓 7737669865 🍓 High Profile Model Escorts | Banga...Mg Road Call Girls Service: 🍓 7737669865 🍓 High Profile Model Escorts | Banga...
Mg Road Call Girls Service: 🍓 7737669865 🍓 High Profile Model Escorts | Banga...amitlee9823
 
Vip Mumbai Call Girls Marol Naka Call On 9920725232 With Body to body massage...
Vip Mumbai Call Girls Marol Naka Call On 9920725232 With Body to body massage...Vip Mumbai Call Girls Marol Naka Call On 9920725232 With Body to body massage...
Vip Mumbai Call Girls Marol Naka Call On 9920725232 With Body to body massage...amitlee9823
 
Call Girls Bommasandra Just Call 👗 7737669865 👗 Top Class Call Girl Service B...
Call Girls Bommasandra Just Call 👗 7737669865 👗 Top Class Call Girl Service B...Call Girls Bommasandra Just Call 👗 7737669865 👗 Top Class Call Girl Service B...
Call Girls Bommasandra Just Call 👗 7737669865 👗 Top Class Call Girl Service B...amitlee9823
 
Call Girls In Attibele ☎ 7737669865 🥵 Book Your One night Stand
Call Girls In Attibele ☎ 7737669865 🥵 Book Your One night StandCall Girls In Attibele ☎ 7737669865 🥵 Book Your One night Stand
Call Girls In Attibele ☎ 7737669865 🥵 Book Your One night Standamitlee9823
 
Cheap Rate Call girls Sarita Vihar Delhi 9205541914 shot 1500 night
Cheap Rate Call girls Sarita Vihar Delhi 9205541914 shot 1500 nightCheap Rate Call girls Sarita Vihar Delhi 9205541914 shot 1500 night
Cheap Rate Call girls Sarita Vihar Delhi 9205541914 shot 1500 nightDelhi Call girls
 
Thane Call Girls 7091864438 Call Girls in Thane Escort service book now -
Thane Call Girls 7091864438 Call Girls in Thane Escort service book now -Thane Call Girls 7091864438 Call Girls in Thane Escort service book now -
Thane Call Girls 7091864438 Call Girls in Thane Escort service book now -Pooja Nehwal
 

Dernier (20)

➥🔝 7737669865 🔝▻ mahisagar Call-girls in Women Seeking Men 🔝mahisagar🔝 Esc...
➥🔝 7737669865 🔝▻ mahisagar Call-girls in Women Seeking Men  🔝mahisagar🔝   Esc...➥🔝 7737669865 🔝▻ mahisagar Call-girls in Women Seeking Men  🔝mahisagar🔝   Esc...
➥🔝 7737669865 🔝▻ mahisagar Call-girls in Women Seeking Men 🔝mahisagar🔝 Esc...
 
VIP Model Call Girls Hinjewadi ( Pune ) Call ON 8005736733 Starting From 5K t...
VIP Model Call Girls Hinjewadi ( Pune ) Call ON 8005736733 Starting From 5K t...VIP Model Call Girls Hinjewadi ( Pune ) Call ON 8005736733 Starting From 5K t...
VIP Model Call Girls Hinjewadi ( Pune ) Call ON 8005736733 Starting From 5K t...
 
Call Girls Indiranagar Just Call 👗 9155563397 👗 Top Class Call Girl Service B...
Call Girls Indiranagar Just Call 👗 9155563397 👗 Top Class Call Girl Service B...Call Girls Indiranagar Just Call 👗 9155563397 👗 Top Class Call Girl Service B...
Call Girls Indiranagar Just Call 👗 9155563397 👗 Top Class Call Girl Service B...
 
April 2024 - Crypto Market Report's Analysis
April 2024 - Crypto Market Report's AnalysisApril 2024 - Crypto Market Report's Analysis
April 2024 - Crypto Market Report's Analysis
 
➥🔝 7737669865 🔝▻ Thrissur Call-girls in Women Seeking Men 🔝Thrissur🔝 Escor...
➥🔝 7737669865 🔝▻ Thrissur Call-girls in Women Seeking Men  🔝Thrissur🔝   Escor...➥🔝 7737669865 🔝▻ Thrissur Call-girls in Women Seeking Men  🔝Thrissur🔝   Escor...
➥🔝 7737669865 🔝▻ Thrissur Call-girls in Women Seeking Men 🔝Thrissur🔝 Escor...
 
Call Girls in Sarai Kale Khan Delhi 💯 Call Us 🔝9205541914 🔝( Delhi) Escorts S...
Call Girls in Sarai Kale Khan Delhi 💯 Call Us 🔝9205541914 🔝( Delhi) Escorts S...Call Girls in Sarai Kale Khan Delhi 💯 Call Us 🔝9205541914 🔝( Delhi) Escorts S...
Call Girls in Sarai Kale Khan Delhi 💯 Call Us 🔝9205541914 🔝( Delhi) Escorts S...
 
hybrid Seed Production In Chilli & Capsicum.pptx
hybrid Seed Production In Chilli & Capsicum.pptxhybrid Seed Production In Chilli & Capsicum.pptx
hybrid Seed Production In Chilli & Capsicum.pptx
 
Junnasandra Call Girls: 🍓 7737669865 🍓 High Profile Model Escorts | Bangalore...
Junnasandra Call Girls: 🍓 7737669865 🍓 High Profile Model Escorts | Bangalore...Junnasandra Call Girls: 🍓 7737669865 🍓 High Profile Model Escorts | Bangalore...
Junnasandra Call Girls: 🍓 7737669865 🍓 High Profile Model Escorts | Bangalore...
 
➥🔝 7737669865 🔝▻ malwa Call-girls in Women Seeking Men 🔝malwa🔝 Escorts Ser...
➥🔝 7737669865 🔝▻ malwa Call-girls in Women Seeking Men  🔝malwa🔝   Escorts Ser...➥🔝 7737669865 🔝▻ malwa Call-girls in Women Seeking Men  🔝malwa🔝   Escorts Ser...
➥🔝 7737669865 🔝▻ malwa Call-girls in Women Seeking Men 🔝malwa🔝 Escorts Ser...
 
Call Girls Begur Just Call 👗 7737669865 👗 Top Class Call Girl Service Bangalore
Call Girls Begur Just Call 👗 7737669865 👗 Top Class Call Girl Service BangaloreCall Girls Begur Just Call 👗 7737669865 👗 Top Class Call Girl Service Bangalore
Call Girls Begur Just Call 👗 7737669865 👗 Top Class Call Girl Service Bangalore
 
Call me @ 9892124323 Cheap Rate Call Girls in Vashi with Real Photo 100% Secure
Call me @ 9892124323  Cheap Rate Call Girls in Vashi with Real Photo 100% SecureCall me @ 9892124323  Cheap Rate Call Girls in Vashi with Real Photo 100% Secure
Call me @ 9892124323 Cheap Rate Call Girls in Vashi with Real Photo 100% Secure
 
Jual Obat Aborsi Surabaya ( Asli No.1 ) 085657271886 Obat Penggugur Kandungan...
Jual Obat Aborsi Surabaya ( Asli No.1 ) 085657271886 Obat Penggugur Kandungan...Jual Obat Aborsi Surabaya ( Asli No.1 ) 085657271886 Obat Penggugur Kandungan...
Jual Obat Aborsi Surabaya ( Asli No.1 ) 085657271886 Obat Penggugur Kandungan...
 
Call Girls In Hsr Layout ☎ 7737669865 🥵 Book Your One night Stand
Call Girls In Hsr Layout ☎ 7737669865 🥵 Book Your One night StandCall Girls In Hsr Layout ☎ 7737669865 🥵 Book Your One night Stand
Call Girls In Hsr Layout ☎ 7737669865 🥵 Book Your One night Stand
 
Discover Why Less is More in B2B Research
Discover Why Less is More in B2B ResearchDiscover Why Less is More in B2B Research
Discover Why Less is More in B2B Research
 
Mg Road Call Girls Service: 🍓 7737669865 🍓 High Profile Model Escorts | Banga...
Mg Road Call Girls Service: 🍓 7737669865 🍓 High Profile Model Escorts | Banga...Mg Road Call Girls Service: 🍓 7737669865 🍓 High Profile Model Escorts | Banga...
Mg Road Call Girls Service: 🍓 7737669865 🍓 High Profile Model Escorts | Banga...
 
Vip Mumbai Call Girls Marol Naka Call On 9920725232 With Body to body massage...
Vip Mumbai Call Girls Marol Naka Call On 9920725232 With Body to body massage...Vip Mumbai Call Girls Marol Naka Call On 9920725232 With Body to body massage...
Vip Mumbai Call Girls Marol Naka Call On 9920725232 With Body to body massage...
 
Call Girls Bommasandra Just Call 👗 7737669865 👗 Top Class Call Girl Service B...
Call Girls Bommasandra Just Call 👗 7737669865 👗 Top Class Call Girl Service B...Call Girls Bommasandra Just Call 👗 7737669865 👗 Top Class Call Girl Service B...
Call Girls Bommasandra Just Call 👗 7737669865 👗 Top Class Call Girl Service B...
 
Call Girls In Attibele ☎ 7737669865 🥵 Book Your One night Stand
Call Girls In Attibele ☎ 7737669865 🥵 Book Your One night StandCall Girls In Attibele ☎ 7737669865 🥵 Book Your One night Stand
Call Girls In Attibele ☎ 7737669865 🥵 Book Your One night Stand
 
Cheap Rate Call girls Sarita Vihar Delhi 9205541914 shot 1500 night
Cheap Rate Call girls Sarita Vihar Delhi 9205541914 shot 1500 nightCheap Rate Call girls Sarita Vihar Delhi 9205541914 shot 1500 night
Cheap Rate Call girls Sarita Vihar Delhi 9205541914 shot 1500 night
 
Thane Call Girls 7091864438 Call Girls in Thane Escort service book now -
Thane Call Girls 7091864438 Call Girls in Thane Escort service book now -Thane Call Girls 7091864438 Call Girls in Thane Escort service book now -
Thane Call Girls 7091864438 Call Girls in Thane Escort service book now -
 

Data Mining and Big Data Analytics in Pharma

  • 1. Drug Research Software Solutions Proposal for XXXX Accommodator Consultancy Services, Lucknow Dr Vibhor Mahendru Ankur Khanna Accommodator Consultancy Services Lucknow
  • 2. Drug Research: Common Challenges  EXPENSIVE! - Drug research is expensive. A new drug takes around 15 years and $1.2b from concept to market.  LOW SUCCESS RATE! - The success ratio is extremely low with most candidate molecules being abandoned midway. Two out of three submissions with regulatory authorities result in failures.  LOW GROWTH RATE! - The typical growth rate has reduced from 13% to 5%. Limited resources.  DUPLICATION OF EFFORT! - Companies often end up duplicating research effort as they fail to determine if similar research is taking place somewhere else.  OMICS EMIT UNMANAGEABLE DATA! - Newer technologies have come in, that deal at gene and cell level. Resulting data is Voluminous, in Various formats and gets piled up at a blistering pace. Drug research faces challenges in leveraging these technologies in a timely, effective , efficient and optimum manner. Accommodator Consultancy Services Lucknow
  • 3. Our Offerings in IT in Life Sciences  TEXT MINING SOLUTIONS  DATA WAREHOUSE SOLUTIONS  DATA MINING SOLUTIONS  DATABASE DEVELOPMENT SOLUTIONS  BIG DATA ANALYTICS  CANCER SOLUTIONS Accommodator Consultancy Services Lucknow
  • 4. TEXT MINING SOLUTIONS Philosophy – Researchers to be able to find new information found in the various scientific reports and papers published around the world and then absorb that information into their ongoing work and give direction to their work by gathering and analyzing trends. Areas Covered:  Patents  Research papers  Publications  Specialized web sites such as Pubchem, Pubmed covering millions of articles  Social media sites such as Facebook, Twitter, Instagram, blogging forums etc,  Internal collection of documents and information. Deliverable: A set of programs that would automatically run and prepare Reports and documents with relevant summarized and detailed information downloaded from above mentioned sources based on input keywords and events. Accommodator Consultancy Services Lucknow
  • 5. WHY PATENT MINING  Patent information of Novel bioactive chemical structures related to drug discovery exceed those in journals by at least five-fold.  Patents encompass academic, as well as commercial, global med. chem. output.  Targets, assays, mechanisms of action, disease descriptions and in-vivo data.  ~ 70% of data initially patent-only, some never disclosed elswhere.  Include synthetic descriptions and other useful enabling information.  Precede journal or meeting reports by ~ 1.5 to 5 years.  Can be complementary to papers (e.g. larger SAR matrix).  Intersect with papers at chemistry, target, disease, author and citation levels  IP exploitable for Neglected Tropical Disease research becoming ”open”. Accommodator Consultancy Services Lucknow
  • 6. PATENT MINING @ NOVARTIS Accommodator Consultancy Services Lucknow MAQALPWLLLWMGAGVLPAHGTQHGIRLPLRSGLGG APLGLRLPRETDEEPEEPGRRGSFVEMVDNLRGKSGQ GYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHR YYQRQLSSTYRDLRKGVYVPYTQGKWEGELGTDLVSI PHGPNVTVRANIAAITESDKFFINGSNWEGILGLAYAEI ARPDDSLEPFFDSLVKQTHVPNLFSLQLCGAGFPLNQSE VLASVGGSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIV RVEINGQDLKMDCKEYNYDKSIVDSGTTNLRLPKKVF EAAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWN IFPVISLYLMGEVTNQSFRITILPQQYLRPVEDVATSQD DCYKFAISQSSTGTVMGAVIMEGFYVVFDRARKRIGFA VSACHVHDEFRTAAVEGPFVTLDMEDCGYNIPQTDEST LMTIAYVMAAICALFMLPLCLMVCQWRCLRCLRQQH DDFADDISLLK Document Assay Result Compound Target
  • 7. DATA MINING SOLUTIONS  Definition - Data Mining is an interdisciplinary subfield of computer science that discovers patterns in large data sets involving methods at the intersection of artificial intelligence, machine learning, statistics, and database systems.  Philosophy – The overall goal of the data mining process is to extract information from a data set and transform it into an understandable structure for further use.  Areas Covered:  Virtual HTS and HCS Data  Predictive Toxicology  Life sciences and health related issues trending on social media  FDA datasets  Micro-biomes  Chemo-genomics  Predicting and preventing diseases through gene analysis  Both big an small molecules  Deliverable: Converting raw data into actionable information after detecting patterns and trends, and applying a number of verified algorithms.  Benefits: Improves prediction of early stage drug safety testing. Data mining (as opposed to conventional statistical analysis) can uncover patterns and relationships in large data volumes that are completely unexpected. Patterns can be used to extrapolate and predict. Accommodator Consultancy Services Lucknow
  • 8. DATA MINING PROCESS & ALGORIGHTMS Accommodator Consultancy Services Lucknow
  • 9. DATA MINING CASE STUDIES @ Roche: Used DM techniques to set up models for the diagnostic of diabetes high risk group to analyze existing samples sets (including Diabetes II patients and healthy subjects), to identify the factors (age, sex, race, height, weight, BMI value, ADA value) that may cause Diabetes II, and predict the probability of the subjects developing Diabetes II in the next 7 and half years, in order to take preventive measures a traditional statistical methods are not as accurate as DM methods. @ GSK: Data Mining Human Gut Microbiota for therapeutic targets. This could lead to a systems-level understanding of the global physiology of the host–microbiota superorganism in health and disease. Such knowledge will provide a platform for the identification and development of new therapeutic strategies for chronic diseases possibly involving microbial as well as human-host targets that improve upon existing probiotics, prebiotics or antibiotics used text analytics to analyze public discussion boards on BabyCenter.com and WhattoExpect.com, to learn what factors motivate parents to either go ahead or delay vaccinating their children for diseases like measles and mumps. Data mining was used to identify unrecognized drug interaction (pravastatin and paroxetine) that suggested raising blood glucose level manifold. However this would need a careful crystallization of the problem statement by experts to make the exercise useful. Accommodator Consultancy Services Lucknow
  • 10. DATA MINING CASE STUDIES @ Bayer: GI adverse effect of short term Aspirin use. Meta analysis of AE comparison with similar drugs for mktg. & drug improvement. @ Pfizer: Uses mining to determine if certain AE’s are being reported with greater frequency than expected. large-scale semantic Web-based data mining and network methods to seek to uncover previously undiscovered historical links between chemical compounds, drugs, biological pathways, targets, genes and diseases. By using big data to bring together genomic data, clinical trials and EMR data, Pfizer was able to develop precise drug ‘Xalkori’ which proves very effective for around 5% of patients suffering from cancer who suffer mutation of their ALK gene. Through data mining, this sub section of population was identified which had a healthy lifestyle, yet got affected by cancer. It funded a study that would use genomic data mining to identify antigens in NTS (non-typhoidal salmonella) that may be used as targets for vaccine development. @ Johnson & Johnson: Has built an open source data management system called Transmart. The idea is to combine genomic data sets, from internal and external sources, using the platform's data standards and processing capabilities. This facilitates data mining which provides immense opportunities. Accommodator Consultancy Services Lucknow
  • 11. DATA MINING CASE STUDIES @ Novartis: In HTS, used Ontology Based Pattern Identification (OPI) algorithm to predict patters by which they were able to find out 1500 scaffold families with significant structure-HTS activity profile relationships. @ Astra Zeneca It uses data-mining tools to identify plausible preclinical Gastro Intestinal effects that may be associated with nausea and that could be of potential use in its prediction. A total of 86 marketed drugs were used in this analysis, and the main outcome was a confirmation that nausogenic and non-nausogenic drugs can be clearly separated based on their preclinical GI observations. . Accommodator Consultancy Services Lucknow
  • 12. CHEMOGENOMICS DATA MINING Chemogenomics is rapidly emerging as a way of helping discover new disease therapies and uncovering new uses for existing drugs. There are large structure activity databases set up by pharmaceutical companies and commercial vendors. These databases can be mined to derive insights into common properties or structural features among ligands linked to common features of the receptors to which they bind. These insights can then used for the rational compilation of screening sets or the knowledge-based synthesis of chemical libraries to accelerate lead finding. Can be used to reposition drugs and find new applications for existing drugs/molecules/compounds. Four Canadian government research funding agencies will spend around US$6.7 million to create a cloud computing facility and data mining tools that will enable researchers to access and use data from the International Cancer Genome Consortium. DM could lead to a systems-level understanding of the global physiology of the host–microbiota superorganism in health and disease. Such knowledge will provide a platform for the identification and development of new therapeutic strategies for chronic diseases possibly involving microbial as well as human-host targets that improve upon existing probiotics, prebiotics or antibiotics We can collect or organize known GPCR and non GPCR ligands and mining models can be trained based on such properties. New compounds can automatically be classified as ligand or non ligand based compound. Design and knowledge based synthesis of chemical libraries targeting subfamily of purinergic GPCR . Chemical scoffolds can be synthesized. Accommodator Consultancy Services Lucknow
  • 13. DATA WAREHOUSE SOLUTIONS Definition – Central repository created by integrating data from disparate sources, with past and current data for both operational and strategic decision making and senior management reporting such as annual comparisons of budget per scientist. Goal – to enable users appropriate access to a homogenized, comprehensive and consistent view of the organization, supporting forecasting and decision- making processes at the enterprise level.. Areas Covered:  Bioinformatics research  Finance  HR  Marketing  Disease Management etc Deliverable: Central repository of useful and actionable data integrated from multiple departments and sources and available to end users for operational and strategic decision making in an efficient and effective manner. Benefits: Better use of internal resources, Reduction in critical time path for statistical analysis. Standard exchange of data with CRO’s, partners and regulatory agencies. Cross trial analysis and leveraged use of historical data. Globalization and knowledge sharing. Facilitates open source drug development. Compliance with regulatory authorities. Accommodator Consultancy Services Lucknow
  • 15. DWH @ NOVARTIS Prominent DWH – FDA’s Janus, Johnson and Johnson, Pfizer, Novartis’ Avalon, GSK and Roche DWH Use Cases: Accommodator Consultancy Services Lucknow
  • 16. DWH USE CASES Novartis: Tell me everything about a given structure  Collect comprehensive data of corporate interest in a single place.  Data grouped by chemical structure.  Standardized data dictionary to describe data.  Chemical structure conventions are unified.  Computed descriptors would be available Given a substructure give me useful calculated descriptors.  Assays physical properties and calculated descriptors are represented uniformly.  Will support changing row model between batch, compound and bioactive. Find all compounds in stock with some publicly known activity.  Integrate structured in house data with external data.  Set the row model by active substance.  Pre defined task based query to automate this kind of query. FDA Janus: Janus creates an integrated data platform for most commercial tools for review, analysis and reporting. It reduces overall cost of information gathering and submissions, development process as well as review and analysis of information. It provides a common data model that is based on the SDTM standard to represent four classes of clinical data submitted to regulatory agencies: tabulation datasets, patient profiles, listings, etc. It provides central access to standardized data, and provides common data views across collaborative partners. It supports cross-trial analyses for data mining and helps detect clinical trends and address clinical hypotheses, and performs more advanced, robust analysis. This enables the ability to contrast and compare data from multiple clinical trials to help improve efficacy and safety. It facilitates a more efficient review process and ability to locate and query data more easily through automated processes and data standards. It provides a potentially broader data view for all clinical trials with proper security, de-identified patient data, and proper agreements in place to share data.Accommodator Consultancy Services Lucknow
  • 17. ERP v/s DWH People confuse between ERP and DWH. They are different as shown below: Accommodator Consultancy Services Lucknow ERP DWH  Detailed  Summarized  Facilitate data entry & storage  Facilitate quick analysis  Used by Operations  Used by Strategists  End users need to be trained  Generalist end users  No AdHoc reporting  Facilitates ad hoc reports  ERP for biochemical less available  Easily integrates and stores biochemical data
  • 18. DATABASE SOLUTIONS Drug discovery analytics is traditionally performed on Relational Database Management Systems. However with new discoveries, it does not remain an optimal choice. Discoveries require newer technologies. Commercial RDBMS have kept pace by introducing newer features (such as column store indexes) We design the RDBMS to consolidate data from disparate sources to facilitate analytics. We also convert existing DBMS systems to leverage newly introduced features. We also undertake performance enhancements, provide additional security and other maintenance tasks. Accommodator Consultancy Services Lucknow
  • 19. BIG DATA SOLUTIONS Definition – A collection of data sets so large and complex that it becomes difficult to process using on-hand database management tools or traditional data processing applications. The challenges include capture, curation, storage, search, sharing, transfer, analysis and visualization. The trend to larger data sets is due to the additional information derivable from analysis of a single large set of related data, as compared to separate smaller sets with the same total amount of data, allowing correlations to be found to "spot business trends, determine quality of research, prevent diseases, link legal citations, combat crime, and determine real-time roadway traffic conditions. Philosophy – To handle such huge data generated by Omics, regular computers are used that are networked/set up in such a way to make it loss proof and leverage individuals processors to work in synergy and solve bigger problems Companies have started offering cloud storage for big data and publicly available. Areas Covered:  Finding cause of diseases  Repositioning of drugs  Prescription of more effective drugs and procedures. Deliverable - We collect information about possible sources of data for related research area. We analyze the data for volume variety and velocity. We do a small pilot prototype of the big data set up using source big data on cloud. We set up programs to collect and process the data and then try to solve the hypothesis Accommodator Consultancy Services Lucknow
  • 20. BIG DATA SOLUTIONS Accommodator Consultancy Services Lucknow Use Case 1: Researchers found that previously undetected mutations in a single gene (called LMX1B) triggered focal segmental glomerulosclerosis (FSGS), a disease that scars the kidneys’ filtering system. This was possible after genome data was collected and compared for healthy and diseased individuals. Use Case 2: Big data approach already has predicted the efficacy of drug repurposing for treating colitis — a form of inflammatory bowel disease — small-cell lung cancer and other conditions, according to Scott Saywell, vice president, corporate development, NuMedii. Use Case 3: For patients, the use of big data analytics in drug development results in less trial and error when physicians prescribe drugs. This tighter targeting of drugs to disease also results in fewer side effects. According to new draft policy by Dept. of Biotechnology, Govt. of India, genome based prescription and treatment will be top priority in next few years. The draft policy envisages converting half of hospitals currently engaged in treatment of human diseases to that of prediction and prevention of diseases using genomic tools. It also aims to provide all available genetic screening tests to general public at affordable prices. Genome data processing and analysis has been possible by Big Data as genome (and other omics technologies) for just one individual results in data that tops 80 story building when translated on a paper.
  • 21. Cancer Solutions Accommodator Consultancy Services Lucknow • We offer collaborate with CDRI and ITRI for providing cancer patients data for further research. • We do research on National Cancer Data Repository providing consultancy on cancer drugs and assisting in cancer research with a goal of personalized cancer solutions. • Any other assistance you would need on this subject.
  • 22. Value that Accommodator Consultancy would add Accommodator Consultancy Services Lucknow  We have vast experience in data analysis, text and data mining and dealing in technologies compatible with biochemical substances having delivered successful projects throughout the world. We will take the IT and statistics worries away from you so you can concentrate on pure research.  We have the skills to be able to work with large volumes of data and Big Data (Hadoop) source systems.  Vast experience in developing, using and configuring different kinds of bioinformatics software.  Team consists of chemist, data warehouse and data mining professional and senior cancer surgeon.  We firmly believe in providing great value in our service/product offering.
  • 23. Questions/Comments? Accommodator Consultancy Services Lucknow In the interest of keeping material short, only a simple summary has been provided. Please do not hesitate to ask any questions/clarification for further details. Our contact details: Ankur Khanna: Director Technical 945 166 8432 Dr Vibhor Mahendru: Director Business Development 800 536 5132 THANK YOU