SlideShare une entreprise Scribd logo
1  sur  46
ARE THE SALIVARY GLAND EPITHELIAL CELLS A TARGET OR AN
ACTOR IN THE SJÖGREN'S SYNDROME PATHOGENESIS?
Simposio de Autoimunidad en Reumatología:
Septiembre 9, 2016 | Bogotá, Colombia
María Julieta González Burgos
Salivary Glands of control subjects and Sjögren’s syndrome
patients are highly complex system
Reflection
Our physiology is a large puzzle; we know little about
each one of the different systems
How can we get specific answers that help us to understand highly
complex diseases such as autoimmune diseases?
So, an intriguing question is:
For me it's a mystery
Yes
No
a dream
……but step by step the answers have slowly been emerging ¡¡¡¡
General aspects of Sjögren's syndrome patients
Sjögren's syndrome is a chronic autoimmune disease that mainly affects
the salivary and lachrymal glands producing severe disorders of mouth and eye
dryness.
This disease has the second highest prevalence after rheumatoid arthritis
and with a ratio of 9:1 exhibiting one of the highest female-to-male ratios among
autoimmune diseases. It is diagnosed around the fourth and fifth decade and its
progress is insidious.
The symptoms are unclear and difficult to diagnose, causing much
frustration for the patient who becomes a conflictive person for their family,
friends and colleagues.
Like all autoimmune diseases, treatments are palliative and the action of
drugs is highly variable. As life expectancy has increased, the autoimmune
diseases have increased considerably and the scientists who study them are still
very scarce.
The National Institute of Health estimated that autoimmune disorders affected 24 million Americans (17 in 100).
¿A que nivel nos ubicamos para hacer una observación?
Salvador Felipe Jacinto Dalí
What level do we stand to make an observation?
Controls
A B C
D E F
Bars: 100m
SS-patients
A B C
D E F
The role of intrinsic epithelial activation in the pathogenesis of Sjögren’s syndrome
Adapted of:
Sjögren’s Syndrome
Novel Insights in Pathogenic,
Clinical and Therapeutic
Aspects
Chapter | 12 page 195, 2016
Glandular epithelial cells are leading actors in the development and maintenance
of Sjögren’s syndrome autoimmune responses.
Salivary gland epithelial cells (SGECs) are suitably equipped to mediate the recruitment
activation and/or differentiation of T and B lymphocytes, macrophages (MΦs), and dendritic
cells (DCs), as well as the organization of infiltrates in the minor salivary glands (MSGs) of SS
patients through the production of cytokines/chemokines. Chapter | 12 page 198, 2016
Journal of Autoimmunity 34 (2010) 400-407J Immunol 2009; 182:3540-3547;
Loss of Acinar Cell Polarity
Normal Acinus Altered Acinus
L
L
Control SS-patients
It is necessary to keep in mind
When we started studying this disease our first finding was to observe
acinar cells that had lost their cell polarity.
So the obvious question was “why did the acinar cells lose their attachment to the basal lamina?
The acinus function
depends on a polarized
architecture that is
based on continuous
dialogue between:
Acinar cells
Cells and Basal lamina
Acinar and myoepithelial
cells
ACINUS
BASAL
APICAL
Cell polarity is maintained by master regulators
PAR6
aPKC
CDC42
Crb
PATJ
PALS
PAR3
aPKC
PTEN
Scrib
Lgl
Dlg
vectoriality
Autoimmunity Reviews 10:175–179,2011
CYTOPLASM
BASAL LAMINA
STROMA
Hemidesmosome Components
Basal Pole
Apical Pole
PLASMA MEMBRANE
Matrix Biology 22: 49–54, 2003Autoimmunity Reviews 10:175–179,2011
ARTHRITIS & RHEUMATISM 43:2807–2817, 2000.
ARTHRITIS & RHEUMATISM 48: 2573–2584, 2003
ARTHRITIS & RHEUMATISM 52: 2751–2760, 2005
Ann Rheum Dis 2006;65;178-183
Salivary glands from SS-patients showed an increased
MMP-3 and MMP-9 expression, as well as MMP-9
catalytic activity. These enzymes were synthesized by
exocrine epithelial cells.
An altered balance between MMPs/TIMPs was detected
Salivary glandular extracts of SS-patients degraded purified
ECM proteins, such as laminins, fibronectin, type 1, III and
IV collagens, among others.
Basal lamina becomes disorganized as a result of
degradation of at least two components, laminin 1 and
type IV collagen.
Ann Rheum Dis 2009;68:991–996.
ARTHRITIS & RHEUMATISM 54: 3465–3475,2006.
ARTHRITIS & RHEUMATISM 63: 1106–1115,2011
Lateral redistribution of α6β4 integrin and the
formation of new cell–cell interactions was observed
Significant increase in BP230 protein levels and the
formation of new hemidesmosomes was found.
Significant increase in both mRNA and protein levels
of laminin α1, α4, and 2 chains showing that the
basal lamina of SG from SS-patients is undergoing
active remodeling.
Together these results showed that the salivary glands from SS-patients display a
molecular potential to disorganize their ECM thus inducing detachment of acinar cells.
However, acinar cells also have activated mechanisms for remodeling of basal lamina and
the renewal of new cell-cell and cell-basal interactions, which help maintain acinar
organization and promote cell survival.
Adapted of Am J Physiol Gastrointest Liver Physiol 279: G250–G254, 2000.
AF6
Rab 3B
Rab 13
PKC
7H6
Simplekin
ASIP
BAP-1
Sec 6/8
ZAK
ZONAB
Occludin
Claudins
Microfilaments of actin
Simplekin
VAP33
JAM
CAR
ZO1
ZO1
Plasma
membrane
CAR
Coxsackievirus and Adenovirus Receptor
Cell 1 Cell 2
Pole Apical
Tight Junctions are Multiproteic Complexes
Protein
Relative Protein Levels (Mean ± SD)
Controls Patients p
Ratio
P/C
Claudin-1 0.2 ± 0.2 0.4 ± 0.2 0.02 2.0
Claudin-3 1.5 ± 0.4 1.2 ± 0.5 0.66 0.8
Claudin-4 0.13 ± 0.1 0.34 ± 0.4 0.04 2.6
Occludin 1.1 ± 1.2
0.5 ± 0.7 0.089 0.45
a1.32 ± 0.8 0.38 1.2
b0.13 ± 0.15 0.004 0.12
ZO-1 0.5± 0.6 0.1 ± 0.1 0.002 0.2
Tight Junction Relative Protein Levels from LSG of SS
Patients
In SS patients, Claudin 1 and 4 were up-regulated, while Occludin
and ZO1 were down-regulated. However, Claudin 3 showed no
change ARTHRITIS & RHEUMATISM 62:1280–1289, 2010
Claudin-3 showed re-distribution from apical
to basal in Acini and Ducts from MSG of SS patients
Acini Ducts
Control
Patient
A A´ B´
C´ D´
B
C D
`L
L
LLL
L
L
L
L
L
ARTHRITIS & RHEUMATISM 62:1280–1289, 2010
Ultrastructure of Tight
Junctions of Acinar
Cells
TJ ultrastructure in the acinar
cells of SS patients showed an
electron-dense material
extending from the apical to
basolateral plasma membrane.
This distribution was similar to
the Claudin 3 distribution.
Cytoplasmic vesicles containing
a similar material were also
observed. Vesicles like exosomes
were observed in the lumen
L
L
B
L
A
d
d
L
Control
Patient
ARTHRITIS & RHEUMATISM 62:1280–1289, 2010
IC
L
L
D
Patient
L
L
IC
Patient
C
L
L
Control
A
L
Patient
B
L
Claudin 3 relocation non-dependent on the proximity of
inflammatory cells
ARTHRITIS & RHEUMATISM 62:1280–1289, 2010
What factors could be participating in this
redistribution?
In other epithelia it has been reported that cytokines
may disorganize TJ. In addition, salivary glands from SS
patients present high levels of these cytokines.
So, we incubated control acini with TNF- alone and
with both TNF- and INF- and then occludin was
identified in these samples.
Control Patient
A B
IC
IC
d
a
a
a
Patient
C
d
a
IC
Patient
D
TNF- immunolocalization in acini, ducts and inflammatory
cell infiltrates of control and SS-patients
ARTHRITIS & RHEUMATISM 62:1280–1289, 2010
C
L
B
L
A Control
TNF- 10ng/ml
TNF- 30ng/ml
L
D
L
TNF- + IFN- 20 ng/ml
Effect of TNF- and/or IFN- on acinus
and localization of occludin
In all experimental
conditions we observed
re-distribution of
occludin
ARTHRITIS & RHEUMATISM 62:1280–1289, 2010
IFN- IFN- and TNF-
(Sci STKE.2006 (316):pe1 Review)
APICAL
What cytokine induced mechanisms cause TJ Disorganization?
STX3
VAMP8
SNAP-23
STX3
VAMP8
STX4
STX4 and
SNAP-23
VAMP8
VAMP8
STX4 and SNAP-23
VAMP8
Munc18
Rab3D
Synaptotagmin
GTP
Syntaxin 4
SNAP-23
Ca2+
Ca2+
Ca2+
NSF
α-SNAP
Mature secretory granule
Plasma membrane
1. Rab GTPases 2. SNARE proteins 3. NSF/αSNAP 4. Modulating proteins
SNARE proteins in
control acinar cells
SNARE proteins are receptors for
membrane fusion
How do changes in cell polarity affect the localization
of proteins involved in regulated exocytosis?
In control acini,
VAMP8 was
localized in the
apical secretory
granules and
the nuclei were
localized in the
basal region of
acinar cells.
In SS-patients,
VAMP8 was
observed all
over the
cytoplasm and
the nuclei had
lost their
polarity.
apical
C
Patient
VAMP8/nuclei
apical
D
apical
B
apical
A
Control
Re-distribution of VAMP8 and loss of nuclear polarity in
acinar cells from MSG of SS-patients
ARTHRITIS & RHEUMATISM 63:3126–3135, 2011
STX3, in control acini is located in the
apical cytoplasm, while in SS-patients it is
observed in all over the cytoplasm.
STX4, in control acini, is mainly localized
next to the basolateral plasma
membrane and to a lesser extent to the
apical plasma membrane. In SS-patients
STX-4 is mainly localized in the basal
plasma membrane.
SNAP-23, in control acini, is mainly
localized in the plasma membrane, while
in SS-patients, it has lower
immunoreactivity, particularly at the
apical and lateral plasma membranes.
Subcellular localization of STX3, STX4,
and SNAP-23 in SS-patients
Journal of Autoimmunity 39: 83-92, 2012
PatientControl
SNAP-23E
apical
A STX3
apical
B
F
DC
STX4
C
Patient
apical
BA
apical
Control Control
apical
B
D
basal
Patient
apical
Considering the re-distribution of SNARE proteins we were interested in determining if
SNARE complexes localized ectopically were formed
1. In acinar cells of SS patients there was a significant
increase in the levels of SNARE complexes for VAMP8
and STX4.
2. In controls, VAMP8 localized to the apical
cytoplasm of acinar cells, whereas in SS-patients
VAMP8 was observed all over the cytoplasm.
Formation of SNARE-complexes in vivo
3. In controls, STX4 localized in all the plasma
membrane, in SS-patients STX4 co-localized with
VAMP8, mainly in basolateral plasma membrane
Journal of Autoimmunity 39: 83-92, 2012
Control
32
100
Monomeric STX4
P25ºC
C25ºC
100
18
kDa
Monomeric VAMP-8
P100ºC
C100ºC
P25ºC
C25ºC
kDa
STX4 SNARE Complex
VAMP8 SNARE Complex
C100ºC
P100ºC
Patient
SNARE COMPLEXES ARE STABLE AT 25ºC
Could these ectopic SNARE complexes participate in
the basal exocytosis of mucins?
Patient
Control
D
m
S
ECM
S
m
S
A
MUC7/LAMININ
B
DIC
C
MUC7/LAMININ/DIC
E F
Presence of secreted MUC7 in the extracellular matrix of MSG from SS-patients
In controls, MUC7 localized in the cytoplasm of acinar cells. In SS patients MUC7 maintained
its localization in the acinar cells, but was also detected atypically in the ECM. The Laminin a
component of the basal lamina marked the boundary of the acinus.
Journal of Autoimmunity 39: 83-92, 2012
Aberrant exocytosis of MUC5B and MUC7
Controls SS-Patients
BASAL
APICAL
LATERAL
VAMP8
STX3
SNAP-23
STX4
Rab3D
Occludin
Claudin-4
Claudin-3
ZO-1
TJ
Basal
Lamina
Summary
Nat Rev Rheumatol 21:186, 2012
J Autoimmunity 42: 7-18,2013
So, we wanted to determine whether
exogenous mucins were able to induce the
expression of pro-inflammatory cytokines in
cultured human salivary cells (HSG).
These results allowed us to conclude that the loss of
acinar cell polarity leads to ectopic exocytosis, which
could explain the oral dryness in these patients.
Golgi/Nucleus
3D acini from HSG cells
Relative mRNA levels of pro-inflammatory cytokines
in HSG cells stimulated with mucins
A significant increase (*) in relative mRNA levels of pro-inflammatory cytokines was
observed. Differences found for BAFF were not significant.
……..So we wondered………..
0
0.5
1
1.5
2
2.5
3
3.5
4
4.5
5
CXCL-8 TNF-α IFN-α IFN-β IL-6 IL-1β BAFF
Cytokine/h18S(Relativeexpressionratio) 0µM
0.001 µM
0.01 µM
0.1 µM
0.2µM
0.4 µM
*
*
*
*
*
*
*
**
*
BSM
Barrera et al, under revision
Are the mucin’s sugar residues involved in
the induction of these cytokines?
Effect of purified MUC5B and Sulfo-Lewis residues in the relative
expression levels of cytokines in HSG cells
Sulfo-Lewis showed a comparable response to purified MUC5B. These results
allowed us to postulate that the mucins might be recognized by their sugar
residues.
Sulfo Lewis : SO3-Galβ1-3GlcNAc is a sulfated disaccharide presents in MUC5B
MUC5B Sulfo-Le BSM
*
*
*
*
*
*
*
*
*
*
*
0
0,5
1
1,5
2
2,5
3
3,5
4
4,5
5
0 0.005 0.015 21.6 54 0.4 µM
Cytokine/h18S(Relativeexpressionratio)
IL-6
TNF-α
IL-1
Barrera et al, manuscript under review
Ligands containing sugar residues can bind Toll like
receptors, such as TLR4. We used the
lipopolysaccharide (LPS), a ligand of TLR4, to induce
expression of cytokines. Then, we compared the LPS-
induced cytokine profile with the mucin-induced
profile.
Comparison between relative mRNA levels of pro-inflammatory
cytokines in HSG cells stimulated with LPS or mucins
Stimulation of HSG cells with TLR4 ligand induced the expression of IL-6 and TNF-α
in a similar manner to stimulation with mucins.
LPS BSM
* *
*
*
*
*
0
0.5
1
1.5
2
2.5
3
3.5
4
4.5
0 0.01 0.1 0.2 0.4 µM
Cytokine/h18S(Relativeexpressionratio)
IL-6
TNF-α
Barrera et al, manuscript under review
The role of TLR4 in cytokine induction was evaluated using TBX2, a peptide that
specifically inhibits TIRAP binding to TLR4. The TNF- and IL-6 expression were
determined.
TBX2: GKMADWFRQTLLKKPKKRPNSPESTLQLRDATPGGAIVS
TBX2
Modified of Cytokine 42 (2008) 145–151Modified of JBiotechnology 129 (2007) 555–564
Dominant-negative domain
TIRAPTBX2
TLR4
MyD88
Molecular modeling and prediction of protein–
protein interaction. TLR4, TIRAP, MyD88 and TBX2
are shown in ribbon representation.
Relative mRNA levels of TNF-α and IL-6 in HSG cells treated with a
TIRAP inhibitory peptide of TLR4
TBX2 selectively inhibited the production of pro-inflammatory cytokines under
the induction of mucins or LPS. This inhibition might have been mediated by
the disruption of the recruitment of downstream effector molecules. Mucins
induced the expression of pro-inflammatory cytokines via TLR4.
TNF-α
#
*
#
*
0
1
2
3
4
5
6
UT TBX2 LPS TBX2/LPS BSM TBX2/BSM
TNF-α/h18S(Relativeexpressionratio)
IL-6
#
*
#
*
0
0.5
1
1.5
2
2.5
3
3.5
4
4.5
UT TBX2 LPS TBX2/LPS BSM TBX2/BSM
IL-6/h18S(Relativeexpressionratio)
Barrera et al, manuscript under review
anti-hTLR4-IgG
Modified of Cytokine 42 (2008) 145–151
To confirm the involvement of TLR4, we used blocking antibodies
against TLR4 and measured TNF- and IL-6 expression in LPS-treated
or mucin-treated cells.
Relative IL-6 mRNA levels in HSG cells treated with
a TLR4-blocking antibody
The specific antibody against TLR4 inhibited the expression of cytokines. These
results demonstrated that mucins induced the expression of pro-inflammatory
cytokines via a TLR4 mediated mechanism.
*
*
#*
*
#
0
0.5
1
1.5
2
2.5
3
3.5
4
IL-6/h18S(Relativeexpressionratio)
Barrera et al, manuscript under review
In HSG cells, exogenous MUC5B and Sulfo-Lewis can induce,
via TLR4, the mRNA expression of pro-inflammatory
cytokines. However, we aren’t discarding the possibility that
galectins and TIM family receptors might also play a role.
A similar response might be observed in the salivary gland
extracellular matrix of SS patients, where the ectopically
secreted mucins may promote the infiltration of inflammatory
cells, a hallmark in the pathogenesis of the disease.
CONCLUSIONS
Concluding Remarks
Cellular interactions are essential for the maintenance of morphological
and functional homeostasis of salivary epithelia.
An important element involved in the development of autoimmunity is the
loss of the protective function of mucosal barriers by disruption of tight junctions.
The potentially pathogenic ectopic secretion of mucins and other factors
into the ECM “may be the initial step in the genesis of the disease”.
Colaborators
National
Sergio Aguilera
Claudio Molina
Sergio González
Cecilia Alliende
Marcela Hermoso
Ulises Urzúa
Andrew Quest
Lisette Leyton
Cecilia Leyton
Internacional
Juan Manuel Anaya
Enno Veerman
Ulla Mandel
Bruce Baum
Henrik Clausen
Inka Brockhausen
FONDECYT
Our Students
Paola Pérez
Eduardo Goicovich
Yoon-Jeoung Kwon
Patricia Ewert
Marianela Sánchez
María José Barrera
Rodrigo Pinto
Mónica Brito
Juan Cortés
Isabel Castro
Verónica Bahamondes
Hsiao Hsin Sung
Camilo Tapia
Denisse Sepúlveda
Hery Urra
José Velozo
Sebastián Indo
Katherine Bravo
Camilo Tapia
Sebastián Puga
Carolina Lagos`
Patricia Carvajal
Nicolás Albornoz
A heartfelt gratitude to our Patients
Model of the changes in assembly of type I-HD
in LSG from SS patients
González S et al ARTHRITIS & RHEUMATISM 63, 2011, 1106–1115

Contenu connexe

Tendances

Premature Vascular Disease in Autoimmunity
Premature Vascular Disease in AutoimmunityPremature Vascular Disease in Autoimmunity
Premature Vascular Disease in AutoimmunityInsideScientific
 
Gen Selden Sigma Xi 2015
Gen Selden Sigma Xi 2015Gen Selden Sigma Xi 2015
Gen Selden Sigma Xi 2015genselden
 
Transcriptional signaling pathways inversely regulated in alzheimer's disease...
Transcriptional signaling pathways inversely regulated in alzheimer's disease...Transcriptional signaling pathways inversely regulated in alzheimer's disease...
Transcriptional signaling pathways inversely regulated in alzheimer's disease...Elsa von Licy
 
Application of RDT in gene therapy
Application of RDT in gene therapyApplication of RDT in gene therapy
Application of RDT in gene therapyANUGYA JAISWAL
 
Antinuclear Antibodies by Bio-Plex 2200
Antinuclear Antibodies by Bio-Plex 2200Antinuclear Antibodies by Bio-Plex 2200
Antinuclear Antibodies by Bio-Plex 2200Marta Talise
 
A Rare Case Report in the Geriatric Practice: Kaposi’s Sarcoma_ Crimson Publi...
A Rare Case Report in the Geriatric Practice: Kaposi’s Sarcoma_ Crimson Publi...A Rare Case Report in the Geriatric Practice: Kaposi’s Sarcoma_ Crimson Publi...
A Rare Case Report in the Geriatric Practice: Kaposi’s Sarcoma_ Crimson Publi...CrimsonpublishersNTNF
 
FoulkesLi2015-PMS2_founder_mismatch_repair
FoulkesLi2015-PMS2_founder_mismatch_repairFoulkesLi2015-PMS2_founder_mismatch_repair
FoulkesLi2015-PMS2_founder_mismatch_repairKristi Baker
 
Adenosine deaminase (ADA) Gene Therapy
Adenosine deaminase (ADA) Gene TherapyAdenosine deaminase (ADA) Gene Therapy
Adenosine deaminase (ADA) Gene TherapyAmna Jalil
 
V EAFO Hematology Forum_Stamatopoulos
V EAFO Hematology Forum_StamatopoulosV EAFO Hematology Forum_Stamatopoulos
V EAFO Hematology Forum_StamatopoulosEAFO1
 

Tendances (20)

Genetics of Alzheimer’s Disease by Denise Harold
Genetics of Alzheimer’s Disease by Denise HaroldGenetics of Alzheimer’s Disease by Denise Harold
Genetics of Alzheimer’s Disease by Denise Harold
 
Alzheimer's disease: Genetic Aspects
Alzheimer's disease: Genetic AspectsAlzheimer's disease: Genetic Aspects
Alzheimer's disease: Genetic Aspects
 
LAMB3(2014)
LAMB3(2014)LAMB3(2014)
LAMB3(2014)
 
Bank1
Bank1Bank1
Bank1
 
Premature Vascular Disease in Autoimmunity
Premature Vascular Disease in AutoimmunityPremature Vascular Disease in Autoimmunity
Premature Vascular Disease in Autoimmunity
 
Gen Selden Sigma Xi 2015
Gen Selden Sigma Xi 2015Gen Selden Sigma Xi 2015
Gen Selden Sigma Xi 2015
 
Transcriptional signaling pathways inversely regulated in alzheimer's disease...
Transcriptional signaling pathways inversely regulated in alzheimer's disease...Transcriptional signaling pathways inversely regulated in alzheimer's disease...
Transcriptional signaling pathways inversely regulated in alzheimer's disease...
 
Application of RDT in gene therapy
Application of RDT in gene therapyApplication of RDT in gene therapy
Application of RDT in gene therapy
 
Antinuclear Antibodies by Bio-Plex 2200
Antinuclear Antibodies by Bio-Plex 2200Antinuclear Antibodies by Bio-Plex 2200
Antinuclear Antibodies by Bio-Plex 2200
 
A Rare Case Report in the Geriatric Practice: Kaposi’s Sarcoma_ Crimson Publi...
A Rare Case Report in the Geriatric Practice: Kaposi’s Sarcoma_ Crimson Publi...A Rare Case Report in the Geriatric Practice: Kaposi’s Sarcoma_ Crimson Publi...
A Rare Case Report in the Geriatric Practice: Kaposi’s Sarcoma_ Crimson Publi...
 
First-line Treatment In In EGFR Mutant NSCLC
First-line Treatment In In EGFR Mutant NSCLCFirst-line Treatment In In EGFR Mutant NSCLC
First-line Treatment In In EGFR Mutant NSCLC
 
FoulkesLi2015-PMS2_founder_mismatch_repair
FoulkesLi2015-PMS2_founder_mismatch_repairFoulkesLi2015-PMS2_founder_mismatch_repair
FoulkesLi2015-PMS2_founder_mismatch_repair
 
Adenosine deaminase (ADA) Gene Therapy
Adenosine deaminase (ADA) Gene TherapyAdenosine deaminase (ADA) Gene Therapy
Adenosine deaminase (ADA) Gene Therapy
 
Marfia_et_al-2014-Glia
Marfia_et_al-2014-GliaMarfia_et_al-2014-Glia
Marfia_et_al-2014-Glia
 
mmc2
mmc2mmc2
mmc2
 
231 genetic marker(s) of mi
231 genetic marker(s) of mi231 genetic marker(s) of mi
231 genetic marker(s) of mi
 
Esv2n51
Esv2n51Esv2n51
Esv2n51
 
V EAFO Hematology Forum_Stamatopoulos
V EAFO Hematology Forum_StamatopoulosV EAFO Hematology Forum_Stamatopoulos
V EAFO Hematology Forum_Stamatopoulos
 
publications
publicationspublications
publications
 
224 k ras polymorphism in cancer, for atherosclerosis
224 k ras polymorphism in cancer, for atherosclerosis224 k ras polymorphism in cancer, for atherosclerosis
224 k ras polymorphism in cancer, for atherosclerosis
 

En vedette

4. Carlos Cañas. Patogénesis del lupus
4. Carlos Cañas. Patogénesis del lupus4. Carlos Cañas. Patogénesis del lupus
4. Carlos Cañas. Patogénesis del lupuscrea-autoinmunidad
 
2. Yeny Acosta. Laboratorio en autoinmunidad
2. Yeny Acosta. Laboratorio en autoinmunidad 2. Yeny Acosta. Laboratorio en autoinmunidad
2. Yeny Acosta. Laboratorio en autoinmunidad crea-autoinmunidad
 
6. Frank Buttgereit. 40 gc update
6. Frank Buttgereit. 40 gc update6. Frank Buttgereit. 40 gc update
6. Frank Buttgereit. 40 gc updatecrea-autoinmunidad
 
1. JM. Anaya. Qué son las enfermedades autoinmunes y por qué son importantes?
1. JM. Anaya. Qué son las enfermedades autoinmunes y por qué son importantes?1. JM. Anaya. Qué son las enfermedades autoinmunes y por qué son importantes?
1. JM. Anaya. Qué son las enfermedades autoinmunes y por qué son importantes?crea-autoinmunidad
 
5. Frank Buttgereit. Fin40 min rheumatic diseases and osteoporosis
5. Frank Buttgereit. Fin40 min rheumatic diseases and osteoporosis5. Frank Buttgereit. Fin40 min rheumatic diseases and osteoporosis
5. Frank Buttgereit. Fin40 min rheumatic diseases and osteoporosiscrea-autoinmunidad
 
3. Frank Buttgereit. Fin40 min ohne gc c&d dmar ds in the treatment of ra
3. Frank Buttgereit. Fin40 min ohne gc c&d dmar ds in the treatment of ra3. Frank Buttgereit. Fin40 min ohne gc c&d dmar ds in the treatment of ra
3. Frank Buttgereit. Fin40 min ohne gc c&d dmar ds in the treatment of racrea-autoinmunidad
 

En vedette (9)

9. Rafael Parra. crea 9 8-16
9. Rafael Parra. crea 9 8-169. Rafael Parra. crea 9 8-16
9. Rafael Parra. crea 9 8-16
 
7. JM Anaya. SS 2016
7. JM Anaya. SS 20167. JM Anaya. SS 2016
7. JM Anaya. SS 2016
 
4. Carlos Cañas. Patogénesis del lupus
4. Carlos Cañas. Patogénesis del lupus4. Carlos Cañas. Patogénesis del lupus
4. Carlos Cañas. Patogénesis del lupus
 
2. Yeny Acosta. Laboratorio en autoinmunidad
2. Yeny Acosta. Laboratorio en autoinmunidad 2. Yeny Acosta. Laboratorio en autoinmunidad
2. Yeny Acosta. Laboratorio en autoinmunidad
 
6. Frank Buttgereit. 40 gc update
6. Frank Buttgereit. 40 gc update6. Frank Buttgereit. 40 gc update
6. Frank Buttgereit. 40 gc update
 
1. JM. Anaya. Qué son las enfermedades autoinmunes y por qué son importantes?
1. JM. Anaya. Qué son las enfermedades autoinmunes y por qué son importantes?1. JM. Anaya. Qué son las enfermedades autoinmunes y por qué son importantes?
1. JM. Anaya. Qué son las enfermedades autoinmunes y por qué son importantes?
 
5. Frank Buttgereit. Fin40 min rheumatic diseases and osteoporosis
5. Frank Buttgereit. Fin40 min rheumatic diseases and osteoporosis5. Frank Buttgereit. Fin40 min rheumatic diseases and osteoporosis
5. Frank Buttgereit. Fin40 min rheumatic diseases and osteoporosis
 
3. Frank Buttgereit. Fin40 min ohne gc c&d dmar ds in the treatment of ra
3. Frank Buttgereit. Fin40 min ohne gc c&d dmar ds in the treatment of ra3. Frank Buttgereit. Fin40 min ohne gc c&d dmar ds in the treatment of ra
3. Frank Buttgereit. Fin40 min ohne gc c&d dmar ds in the treatment of ra
 
Lipidos
LipidosLipidos
Lipidos
 

Similaire à 8. Julieta Gonzalez. Bogota epithelial cells in lsg from ss patients

Abstract piis0022202 x1831114x
Abstract piis0022202 x1831114xAbstract piis0022202 x1831114x
Abstract piis0022202 x1831114xWaddah Moghram
 
Final Dissertation
Final DissertationFinal Dissertation
Final DissertationRachel Li
 
Sjögren's_syndrome~_Role_for_Cevimeline
Sjögren's_syndrome~_Role_for_CevimelineSjögren's_syndrome~_Role_for_Cevimeline
Sjögren's_syndrome~_Role_for_CevimelineFlavio Guzmán
 
Most Recent Studies About Stem Cell & Autoimmune Disease
Most Recent Studies About Stem Cell & Autoimmune DiseaseMost Recent Studies About Stem Cell & Autoimmune Disease
Most Recent Studies About Stem Cell & Autoimmune Diseasemeducationdotnet
 
Dr. masciotra shear wave elastography and more in a clinical case of multip...
Dr. masciotra   shear wave elastography and more in a clinical case of multip...Dr. masciotra   shear wave elastography and more in a clinical case of multip...
Dr. masciotra shear wave elastography and more in a clinical case of multip...antonio pio masciotra
 
Mucopolysaccharidoses II and III Diseases Paper
Mucopolysaccharidoses II and III Diseases PaperMucopolysaccharidoses II and III Diseases Paper
Mucopolysaccharidoses II and III Diseases PaperFahim Zubair
 
Anti Mullerian Hormone in Transfusion Dependent B- Thalassemia and Chronic Id...
Anti Mullerian Hormone in Transfusion Dependent B- Thalassemia and Chronic Id...Anti Mullerian Hormone in Transfusion Dependent B- Thalassemia and Chronic Id...
Anti Mullerian Hormone in Transfusion Dependent B- Thalassemia and Chronic Id...Healthcare and Medical Sciences
 
KLF4-dependent phenotypic modulation of smooth muscle cells has a key role in...
KLF4-dependent phenotypic modulation of smooth muscle cells has a key role in...KLF4-dependent phenotypic modulation of smooth muscle cells has a key role in...
KLF4-dependent phenotypic modulation of smooth muscle cells has a key role in...Laura Shankman
 
Biomarkers of Systemic Lupus Erythematosus and Systemic Sclerosis diseases ac...
Biomarkers of Systemic Lupus Erythematosus and Systemic Sclerosis diseases ac...Biomarkers of Systemic Lupus Erythematosus and Systemic Sclerosis diseases ac...
Biomarkers of Systemic Lupus Erythematosus and Systemic Sclerosis diseases ac...Prof. Hesham N. Mustafa
 
Experimental Analysis of Tear Fluid and their Processing for the Diagnosis of...
Experimental Analysis of Tear Fluid and their Processing for the Diagnosis of...Experimental Analysis of Tear Fluid and their Processing for the Diagnosis of...
Experimental Analysis of Tear Fluid and their Processing for the Diagnosis of...semualkaira
 
Experimental Analysis of Tear Fluid and their Processing for the Diagnosis of...
Experimental Analysis of Tear Fluid and their Processing for the Diagnosis of...Experimental Analysis of Tear Fluid and their Processing for the Diagnosis of...
Experimental Analysis of Tear Fluid and their Processing for the Diagnosis of...semualkaira
 
Experimental Analysis of Tear Fluid and their Processing for the Diagnosis of...
Experimental Analysis of Tear Fluid and their Processing for the Diagnosis of...Experimental Analysis of Tear Fluid and their Processing for the Diagnosis of...
Experimental Analysis of Tear Fluid and their Processing for the Diagnosis of...semualkaira
 
Experimental Analysis of Tear Fluid and their Processing for the Diagnosis of...
Experimental Analysis of Tear Fluid and their Processing for the Diagnosis of...Experimental Analysis of Tear Fluid and their Processing for the Diagnosis of...
Experimental Analysis of Tear Fluid and their Processing for the Diagnosis of...semualkaira
 
JUNE 2015 POSTER
JUNE 2015 POSTERJUNE 2015 POSTER
JUNE 2015 POSTER5jor13
 
Order a20171110 83
Order a20171110 83Order a20171110 83
Order a20171110 83Thomas Ndalo
 

Similaire à 8. Julieta Gonzalez. Bogota epithelial cells in lsg from ss patients (20)

Abstract piis0022202 x1831114x
Abstract piis0022202 x1831114xAbstract piis0022202 x1831114x
Abstract piis0022202 x1831114x
 
Final Dissertation
Final DissertationFinal Dissertation
Final Dissertation
 
Sjögren's_syndrome~_Role_for_Cevimeline
Sjögren's_syndrome~_Role_for_CevimelineSjögren's_syndrome~_Role_for_Cevimeline
Sjögren's_syndrome~_Role_for_Cevimeline
 
Most Recent Studies About Stem Cell & Autoimmune Disease
Most Recent Studies About Stem Cell & Autoimmune DiseaseMost Recent Studies About Stem Cell & Autoimmune Disease
Most Recent Studies About Stem Cell & Autoimmune Disease
 
MPGN.pptx
MPGN.pptxMPGN.pptx
MPGN.pptx
 
Dr. masciotra shear wave elastography and more in a clinical case of multip...
Dr. masciotra   shear wave elastography and more in a clinical case of multip...Dr. masciotra   shear wave elastography and more in a clinical case of multip...
Dr. masciotra shear wave elastography and more in a clinical case of multip...
 
Bio341.Final.new
Bio341.Final.newBio341.Final.new
Bio341.Final.new
 
Mucopolysaccharidoses II and III Diseases Paper
Mucopolysaccharidoses II and III Diseases PaperMucopolysaccharidoses II and III Diseases Paper
Mucopolysaccharidoses II and III Diseases Paper
 
Sma ppt
Sma pptSma ppt
Sma ppt
 
Sjogren ppt
Sjogren pptSjogren ppt
Sjogren ppt
 
Anti Mullerian Hormone in Transfusion Dependent B- Thalassemia and Chronic Id...
Anti Mullerian Hormone in Transfusion Dependent B- Thalassemia and Chronic Id...Anti Mullerian Hormone in Transfusion Dependent B- Thalassemia and Chronic Id...
Anti Mullerian Hormone in Transfusion Dependent B- Thalassemia and Chronic Id...
 
KLF4-dependent phenotypic modulation of smooth muscle cells has a key role in...
KLF4-dependent phenotypic modulation of smooth muscle cells has a key role in...KLF4-dependent phenotypic modulation of smooth muscle cells has a key role in...
KLF4-dependent phenotypic modulation of smooth muscle cells has a key role in...
 
Biomarkers of Systemic Lupus Erythematosus and Systemic Sclerosis diseases ac...
Biomarkers of Systemic Lupus Erythematosus and Systemic Sclerosis diseases ac...Biomarkers of Systemic Lupus Erythematosus and Systemic Sclerosis diseases ac...
Biomarkers of Systemic Lupus Erythematosus and Systemic Sclerosis diseases ac...
 
Experimental Analysis of Tear Fluid and their Processing for the Diagnosis of...
Experimental Analysis of Tear Fluid and their Processing for the Diagnosis of...Experimental Analysis of Tear Fluid and their Processing for the Diagnosis of...
Experimental Analysis of Tear Fluid and their Processing for the Diagnosis of...
 
Experimental Analysis of Tear Fluid and their Processing for the Diagnosis of...
Experimental Analysis of Tear Fluid and their Processing for the Diagnosis of...Experimental Analysis of Tear Fluid and their Processing for the Diagnosis of...
Experimental Analysis of Tear Fluid and their Processing for the Diagnosis of...
 
Experimental Analysis of Tear Fluid and their Processing for the Diagnosis of...
Experimental Analysis of Tear Fluid and their Processing for the Diagnosis of...Experimental Analysis of Tear Fluid and their Processing for the Diagnosis of...
Experimental Analysis of Tear Fluid and their Processing for the Diagnosis of...
 
Experimental Analysis of Tear Fluid and their Processing for the Diagnosis of...
Experimental Analysis of Tear Fluid and their Processing for the Diagnosis of...Experimental Analysis of Tear Fluid and their Processing for the Diagnosis of...
Experimental Analysis of Tear Fluid and their Processing for the Diagnosis of...
 
JUNE 2015 POSTER
JUNE 2015 POSTERJUNE 2015 POSTER
JUNE 2015 POSTER
 
Order a20171110 83
Order a20171110 83Order a20171110 83
Order a20171110 83
 
Hepatic Irradiation
Hepatic IrradiationHepatic Irradiation
Hepatic Irradiation
 

Dernier

VIP Hyderabad Call Girls Bahadurpally 7877925207 ₹5000 To 25K With AC Room 💚😋
VIP Hyderabad Call Girls Bahadurpally 7877925207 ₹5000 To 25K With AC Room 💚😋VIP Hyderabad Call Girls Bahadurpally 7877925207 ₹5000 To 25K With AC Room 💚😋
VIP Hyderabad Call Girls Bahadurpally 7877925207 ₹5000 To 25K With AC Room 💚😋TANUJA PANDEY
 
Call Girls Coimbatore Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Coimbatore Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Coimbatore Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Coimbatore Just Call 9907093804 Top Class Call Girl Service AvailableDipal Arora
 
(Low Rate RASHMI ) Rate Of Call Girls Jaipur ❣ 8445551418 ❣ Elite Models & Ce...
(Low Rate RASHMI ) Rate Of Call Girls Jaipur ❣ 8445551418 ❣ Elite Models & Ce...(Low Rate RASHMI ) Rate Of Call Girls Jaipur ❣ 8445551418 ❣ Elite Models & Ce...
(Low Rate RASHMI ) Rate Of Call Girls Jaipur ❣ 8445551418 ❣ Elite Models & Ce...parulsinha
 
Call Girls Gwalior Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Gwalior Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Gwalior Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Gwalior Just Call 9907093804 Top Class Call Girl Service AvailableDipal Arora
 
Manyata Tech Park ( Call Girls ) Bangalore ✔ 6297143586 ✔ Hot Model With Sexy...
Manyata Tech Park ( Call Girls ) Bangalore ✔ 6297143586 ✔ Hot Model With Sexy...Manyata Tech Park ( Call Girls ) Bangalore ✔ 6297143586 ✔ Hot Model With Sexy...
Manyata Tech Park ( Call Girls ) Bangalore ✔ 6297143586 ✔ Hot Model With Sexy...vidya singh
 
(Rocky) Jaipur Call Girl - 09521753030 Escorts Service 50% Off with Cash ON D...
(Rocky) Jaipur Call Girl - 09521753030 Escorts Service 50% Off with Cash ON D...(Rocky) Jaipur Call Girl - 09521753030 Escorts Service 50% Off with Cash ON D...
(Rocky) Jaipur Call Girl - 09521753030 Escorts Service 50% Off with Cash ON D...indiancallgirl4rent
 
(👑VVIP ISHAAN ) Russian Call Girls Service Navi Mumbai🖕9920874524🖕Independent...
(👑VVIP ISHAAN ) Russian Call Girls Service Navi Mumbai🖕9920874524🖕Independent...(👑VVIP ISHAAN ) Russian Call Girls Service Navi Mumbai🖕9920874524🖕Independent...
(👑VVIP ISHAAN ) Russian Call Girls Service Navi Mumbai🖕9920874524🖕Independent...Taniya Sharma
 
Call Girls Varanasi Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Varanasi Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Varanasi Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Varanasi Just Call 9907093804 Top Class Call Girl Service AvailableDipal Arora
 
💎VVIP Kolkata Call Girls Parganas🩱7001035870🩱Independent Girl ( Ac Rooms Avai...
💎VVIP Kolkata Call Girls Parganas🩱7001035870🩱Independent Girl ( Ac Rooms Avai...💎VVIP Kolkata Call Girls Parganas🩱7001035870🩱Independent Girl ( Ac Rooms Avai...
💎VVIP Kolkata Call Girls Parganas🩱7001035870🩱Independent Girl ( Ac Rooms Avai...Taniya Sharma
 
Top Rated Bangalore Call Girls Richmond Circle ⟟ 9332606886 ⟟ Call Me For Ge...
Top Rated Bangalore Call Girls Richmond Circle ⟟  9332606886 ⟟ Call Me For Ge...Top Rated Bangalore Call Girls Richmond Circle ⟟  9332606886 ⟟ Call Me For Ge...
Top Rated Bangalore Call Girls Richmond Circle ⟟ 9332606886 ⟟ Call Me For Ge...narwatsonia7
 
Night 7k to 12k Chennai City Center Call Girls 👉👉 7427069034⭐⭐ 100% Genuine E...
Night 7k to 12k Chennai City Center Call Girls 👉👉 7427069034⭐⭐ 100% Genuine E...Night 7k to 12k Chennai City Center Call Girls 👉👉 7427069034⭐⭐ 100% Genuine E...
Night 7k to 12k Chennai City Center Call Girls 👉👉 7427069034⭐⭐ 100% Genuine E...hotbabesbook
 
Top Quality Call Girl Service Kalyanpur 6378878445 Available Call Girls Any Time
Top Quality Call Girl Service Kalyanpur 6378878445 Available Call Girls Any TimeTop Quality Call Girl Service Kalyanpur 6378878445 Available Call Girls Any Time
Top Quality Call Girl Service Kalyanpur 6378878445 Available Call Girls Any TimeCall Girls Delhi
 
Call Girls Jabalpur Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Jabalpur Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Jabalpur Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Jabalpur Just Call 9907093804 Top Class Call Girl Service AvailableDipal Arora
 
Call Girls Bhubaneswar Just Call 9907093804 Top Class Call Girl Service Avail...
Call Girls Bhubaneswar Just Call 9907093804 Top Class Call Girl Service Avail...Call Girls Bhubaneswar Just Call 9907093804 Top Class Call Girl Service Avail...
Call Girls Bhubaneswar Just Call 9907093804 Top Class Call Girl Service Avail...Dipal Arora
 
Premium Call Girls Cottonpet Whatsapp 7001035870 Independent Escort Service
Premium Call Girls Cottonpet Whatsapp 7001035870 Independent Escort ServicePremium Call Girls Cottonpet Whatsapp 7001035870 Independent Escort Service
Premium Call Girls Cottonpet Whatsapp 7001035870 Independent Escort Servicevidya singh
 
Call Girls Ooty Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Ooty Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Ooty Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Ooty Just Call 9907093804 Top Class Call Girl Service AvailableDipal Arora
 
Call Girls Faridabad Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Faridabad Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Faridabad Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Faridabad Just Call 9907093804 Top Class Call Girl Service AvailableDipal Arora
 
Night 7k to 12k Navi Mumbai Call Girl Photo 👉 BOOK NOW 9833363713 👈 ♀️ night ...
Night 7k to 12k Navi Mumbai Call Girl Photo 👉 BOOK NOW 9833363713 👈 ♀️ night ...Night 7k to 12k Navi Mumbai Call Girl Photo 👉 BOOK NOW 9833363713 👈 ♀️ night ...
Night 7k to 12k Navi Mumbai Call Girl Photo 👉 BOOK NOW 9833363713 👈 ♀️ night ...aartirawatdelhi
 
College Call Girls in Haridwar 9667172968 Short 4000 Night 10000 Best call gi...
College Call Girls in Haridwar 9667172968 Short 4000 Night 10000 Best call gi...College Call Girls in Haridwar 9667172968 Short 4000 Night 10000 Best call gi...
College Call Girls in Haridwar 9667172968 Short 4000 Night 10000 Best call gi...perfect solution
 
Top Rated Hyderabad Call Girls Erragadda ⟟ 6297143586 ⟟ Call Me For Genuine ...
Top Rated  Hyderabad Call Girls Erragadda ⟟ 6297143586 ⟟ Call Me For Genuine ...Top Rated  Hyderabad Call Girls Erragadda ⟟ 6297143586 ⟟ Call Me For Genuine ...
Top Rated Hyderabad Call Girls Erragadda ⟟ 6297143586 ⟟ Call Me For Genuine ...chandars293
 

Dernier (20)

VIP Hyderabad Call Girls Bahadurpally 7877925207 ₹5000 To 25K With AC Room 💚😋
VIP Hyderabad Call Girls Bahadurpally 7877925207 ₹5000 To 25K With AC Room 💚😋VIP Hyderabad Call Girls Bahadurpally 7877925207 ₹5000 To 25K With AC Room 💚😋
VIP Hyderabad Call Girls Bahadurpally 7877925207 ₹5000 To 25K With AC Room 💚😋
 
Call Girls Coimbatore Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Coimbatore Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Coimbatore Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Coimbatore Just Call 9907093804 Top Class Call Girl Service Available
 
(Low Rate RASHMI ) Rate Of Call Girls Jaipur ❣ 8445551418 ❣ Elite Models & Ce...
(Low Rate RASHMI ) Rate Of Call Girls Jaipur ❣ 8445551418 ❣ Elite Models & Ce...(Low Rate RASHMI ) Rate Of Call Girls Jaipur ❣ 8445551418 ❣ Elite Models & Ce...
(Low Rate RASHMI ) Rate Of Call Girls Jaipur ❣ 8445551418 ❣ Elite Models & Ce...
 
Call Girls Gwalior Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Gwalior Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Gwalior Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Gwalior Just Call 9907093804 Top Class Call Girl Service Available
 
Manyata Tech Park ( Call Girls ) Bangalore ✔ 6297143586 ✔ Hot Model With Sexy...
Manyata Tech Park ( Call Girls ) Bangalore ✔ 6297143586 ✔ Hot Model With Sexy...Manyata Tech Park ( Call Girls ) Bangalore ✔ 6297143586 ✔ Hot Model With Sexy...
Manyata Tech Park ( Call Girls ) Bangalore ✔ 6297143586 ✔ Hot Model With Sexy...
 
(Rocky) Jaipur Call Girl - 09521753030 Escorts Service 50% Off with Cash ON D...
(Rocky) Jaipur Call Girl - 09521753030 Escorts Service 50% Off with Cash ON D...(Rocky) Jaipur Call Girl - 09521753030 Escorts Service 50% Off with Cash ON D...
(Rocky) Jaipur Call Girl - 09521753030 Escorts Service 50% Off with Cash ON D...
 
(👑VVIP ISHAAN ) Russian Call Girls Service Navi Mumbai🖕9920874524🖕Independent...
(👑VVIP ISHAAN ) Russian Call Girls Service Navi Mumbai🖕9920874524🖕Independent...(👑VVIP ISHAAN ) Russian Call Girls Service Navi Mumbai🖕9920874524🖕Independent...
(👑VVIP ISHAAN ) Russian Call Girls Service Navi Mumbai🖕9920874524🖕Independent...
 
Call Girls Varanasi Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Varanasi Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Varanasi Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Varanasi Just Call 9907093804 Top Class Call Girl Service Available
 
💎VVIP Kolkata Call Girls Parganas🩱7001035870🩱Independent Girl ( Ac Rooms Avai...
💎VVIP Kolkata Call Girls Parganas🩱7001035870🩱Independent Girl ( Ac Rooms Avai...💎VVIP Kolkata Call Girls Parganas🩱7001035870🩱Independent Girl ( Ac Rooms Avai...
💎VVIP Kolkata Call Girls Parganas🩱7001035870🩱Independent Girl ( Ac Rooms Avai...
 
Top Rated Bangalore Call Girls Richmond Circle ⟟ 9332606886 ⟟ Call Me For Ge...
Top Rated Bangalore Call Girls Richmond Circle ⟟  9332606886 ⟟ Call Me For Ge...Top Rated Bangalore Call Girls Richmond Circle ⟟  9332606886 ⟟ Call Me For Ge...
Top Rated Bangalore Call Girls Richmond Circle ⟟ 9332606886 ⟟ Call Me For Ge...
 
Night 7k to 12k Chennai City Center Call Girls 👉👉 7427069034⭐⭐ 100% Genuine E...
Night 7k to 12k Chennai City Center Call Girls 👉👉 7427069034⭐⭐ 100% Genuine E...Night 7k to 12k Chennai City Center Call Girls 👉👉 7427069034⭐⭐ 100% Genuine E...
Night 7k to 12k Chennai City Center Call Girls 👉👉 7427069034⭐⭐ 100% Genuine E...
 
Top Quality Call Girl Service Kalyanpur 6378878445 Available Call Girls Any Time
Top Quality Call Girl Service Kalyanpur 6378878445 Available Call Girls Any TimeTop Quality Call Girl Service Kalyanpur 6378878445 Available Call Girls Any Time
Top Quality Call Girl Service Kalyanpur 6378878445 Available Call Girls Any Time
 
Call Girls Jabalpur Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Jabalpur Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Jabalpur Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Jabalpur Just Call 9907093804 Top Class Call Girl Service Available
 
Call Girls Bhubaneswar Just Call 9907093804 Top Class Call Girl Service Avail...
Call Girls Bhubaneswar Just Call 9907093804 Top Class Call Girl Service Avail...Call Girls Bhubaneswar Just Call 9907093804 Top Class Call Girl Service Avail...
Call Girls Bhubaneswar Just Call 9907093804 Top Class Call Girl Service Avail...
 
Premium Call Girls Cottonpet Whatsapp 7001035870 Independent Escort Service
Premium Call Girls Cottonpet Whatsapp 7001035870 Independent Escort ServicePremium Call Girls Cottonpet Whatsapp 7001035870 Independent Escort Service
Premium Call Girls Cottonpet Whatsapp 7001035870 Independent Escort Service
 
Call Girls Ooty Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Ooty Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Ooty Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Ooty Just Call 9907093804 Top Class Call Girl Service Available
 
Call Girls Faridabad Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Faridabad Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Faridabad Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Faridabad Just Call 9907093804 Top Class Call Girl Service Available
 
Night 7k to 12k Navi Mumbai Call Girl Photo 👉 BOOK NOW 9833363713 👈 ♀️ night ...
Night 7k to 12k Navi Mumbai Call Girl Photo 👉 BOOK NOW 9833363713 👈 ♀️ night ...Night 7k to 12k Navi Mumbai Call Girl Photo 👉 BOOK NOW 9833363713 👈 ♀️ night ...
Night 7k to 12k Navi Mumbai Call Girl Photo 👉 BOOK NOW 9833363713 👈 ♀️ night ...
 
College Call Girls in Haridwar 9667172968 Short 4000 Night 10000 Best call gi...
College Call Girls in Haridwar 9667172968 Short 4000 Night 10000 Best call gi...College Call Girls in Haridwar 9667172968 Short 4000 Night 10000 Best call gi...
College Call Girls in Haridwar 9667172968 Short 4000 Night 10000 Best call gi...
 
Top Rated Hyderabad Call Girls Erragadda ⟟ 6297143586 ⟟ Call Me For Genuine ...
Top Rated  Hyderabad Call Girls Erragadda ⟟ 6297143586 ⟟ Call Me For Genuine ...Top Rated  Hyderabad Call Girls Erragadda ⟟ 6297143586 ⟟ Call Me For Genuine ...
Top Rated Hyderabad Call Girls Erragadda ⟟ 6297143586 ⟟ Call Me For Genuine ...
 

8. Julieta Gonzalez. Bogota epithelial cells in lsg from ss patients

  • 1. ARE THE SALIVARY GLAND EPITHELIAL CELLS A TARGET OR AN ACTOR IN THE SJÖGREN'S SYNDROME PATHOGENESIS? Simposio de Autoimunidad en Reumatología: Septiembre 9, 2016 | Bogotá, Colombia María Julieta González Burgos
  • 2. Salivary Glands of control subjects and Sjögren’s syndrome patients are highly complex system Reflection Our physiology is a large puzzle; we know little about each one of the different systems
  • 3. How can we get specific answers that help us to understand highly complex diseases such as autoimmune diseases? So, an intriguing question is: For me it's a mystery Yes No a dream ……but step by step the answers have slowly been emerging ¡¡¡¡
  • 4. General aspects of Sjögren's syndrome patients Sjögren's syndrome is a chronic autoimmune disease that mainly affects the salivary and lachrymal glands producing severe disorders of mouth and eye dryness. This disease has the second highest prevalence after rheumatoid arthritis and with a ratio of 9:1 exhibiting one of the highest female-to-male ratios among autoimmune diseases. It is diagnosed around the fourth and fifth decade and its progress is insidious. The symptoms are unclear and difficult to diagnose, causing much frustration for the patient who becomes a conflictive person for their family, friends and colleagues. Like all autoimmune diseases, treatments are palliative and the action of drugs is highly variable. As life expectancy has increased, the autoimmune diseases have increased considerably and the scientists who study them are still very scarce. The National Institute of Health estimated that autoimmune disorders affected 24 million Americans (17 in 100).
  • 5. ¿A que nivel nos ubicamos para hacer una observación? Salvador Felipe Jacinto Dalí What level do we stand to make an observation?
  • 6. Controls A B C D E F Bars: 100m SS-patients A B C D E F
  • 7. The role of intrinsic epithelial activation in the pathogenesis of Sjögren’s syndrome Adapted of: Sjögren’s Syndrome Novel Insights in Pathogenic, Clinical and Therapeutic Aspects Chapter | 12 page 195, 2016
  • 8. Glandular epithelial cells are leading actors in the development and maintenance of Sjögren’s syndrome autoimmune responses. Salivary gland epithelial cells (SGECs) are suitably equipped to mediate the recruitment activation and/or differentiation of T and B lymphocytes, macrophages (MΦs), and dendritic cells (DCs), as well as the organization of infiltrates in the minor salivary glands (MSGs) of SS patients through the production of cytokines/chemokines. Chapter | 12 page 198, 2016
  • 9. Journal of Autoimmunity 34 (2010) 400-407J Immunol 2009; 182:3540-3547;
  • 10. Loss of Acinar Cell Polarity Normal Acinus Altered Acinus L L Control SS-patients It is necessary to keep in mind When we started studying this disease our first finding was to observe acinar cells that had lost their cell polarity. So the obvious question was “why did the acinar cells lose their attachment to the basal lamina?
  • 11. The acinus function depends on a polarized architecture that is based on continuous dialogue between: Acinar cells Cells and Basal lamina Acinar and myoepithelial cells ACINUS
  • 12. BASAL APICAL Cell polarity is maintained by master regulators PAR6 aPKC CDC42 Crb PATJ PALS PAR3 aPKC PTEN Scrib Lgl Dlg vectoriality Autoimmunity Reviews 10:175–179,2011
  • 13. CYTOPLASM BASAL LAMINA STROMA Hemidesmosome Components Basal Pole Apical Pole PLASMA MEMBRANE Matrix Biology 22: 49–54, 2003Autoimmunity Reviews 10:175–179,2011
  • 14. ARTHRITIS & RHEUMATISM 43:2807–2817, 2000. ARTHRITIS & RHEUMATISM 48: 2573–2584, 2003 ARTHRITIS & RHEUMATISM 52: 2751–2760, 2005 Ann Rheum Dis 2006;65;178-183 Salivary glands from SS-patients showed an increased MMP-3 and MMP-9 expression, as well as MMP-9 catalytic activity. These enzymes were synthesized by exocrine epithelial cells. An altered balance between MMPs/TIMPs was detected Salivary glandular extracts of SS-patients degraded purified ECM proteins, such as laminins, fibronectin, type 1, III and IV collagens, among others. Basal lamina becomes disorganized as a result of degradation of at least two components, laminin 1 and type IV collagen.
  • 15. Ann Rheum Dis 2009;68:991–996. ARTHRITIS & RHEUMATISM 54: 3465–3475,2006. ARTHRITIS & RHEUMATISM 63: 1106–1115,2011 Lateral redistribution of α6β4 integrin and the formation of new cell–cell interactions was observed Significant increase in BP230 protein levels and the formation of new hemidesmosomes was found. Significant increase in both mRNA and protein levels of laminin α1, α4, and 2 chains showing that the basal lamina of SG from SS-patients is undergoing active remodeling. Together these results showed that the salivary glands from SS-patients display a molecular potential to disorganize their ECM thus inducing detachment of acinar cells. However, acinar cells also have activated mechanisms for remodeling of basal lamina and the renewal of new cell-cell and cell-basal interactions, which help maintain acinar organization and promote cell survival.
  • 16. Adapted of Am J Physiol Gastrointest Liver Physiol 279: G250–G254, 2000. AF6 Rab 3B Rab 13 PKC 7H6 Simplekin ASIP BAP-1 Sec 6/8 ZAK ZONAB Occludin Claudins Microfilaments of actin Simplekin VAP33 JAM CAR ZO1 ZO1 Plasma membrane CAR Coxsackievirus and Adenovirus Receptor Cell 1 Cell 2 Pole Apical Tight Junctions are Multiproteic Complexes
  • 17. Protein Relative Protein Levels (Mean ± SD) Controls Patients p Ratio P/C Claudin-1 0.2 ± 0.2 0.4 ± 0.2 0.02 2.0 Claudin-3 1.5 ± 0.4 1.2 ± 0.5 0.66 0.8 Claudin-4 0.13 ± 0.1 0.34 ± 0.4 0.04 2.6 Occludin 1.1 ± 1.2 0.5 ± 0.7 0.089 0.45 a1.32 ± 0.8 0.38 1.2 b0.13 ± 0.15 0.004 0.12 ZO-1 0.5± 0.6 0.1 ± 0.1 0.002 0.2 Tight Junction Relative Protein Levels from LSG of SS Patients In SS patients, Claudin 1 and 4 were up-regulated, while Occludin and ZO1 were down-regulated. However, Claudin 3 showed no change ARTHRITIS & RHEUMATISM 62:1280–1289, 2010
  • 18. Claudin-3 showed re-distribution from apical to basal in Acini and Ducts from MSG of SS patients Acini Ducts Control Patient A A´ B´ C´ D´ B C D `L L LLL L L L L L ARTHRITIS & RHEUMATISM 62:1280–1289, 2010
  • 19. Ultrastructure of Tight Junctions of Acinar Cells TJ ultrastructure in the acinar cells of SS patients showed an electron-dense material extending from the apical to basolateral plasma membrane. This distribution was similar to the Claudin 3 distribution. Cytoplasmic vesicles containing a similar material were also observed. Vesicles like exosomes were observed in the lumen L L B L A d d L Control Patient ARTHRITIS & RHEUMATISM 62:1280–1289, 2010
  • 20. IC L L D Patient L L IC Patient C L L Control A L Patient B L Claudin 3 relocation non-dependent on the proximity of inflammatory cells ARTHRITIS & RHEUMATISM 62:1280–1289, 2010
  • 21. What factors could be participating in this redistribution? In other epithelia it has been reported that cytokines may disorganize TJ. In addition, salivary glands from SS patients present high levels of these cytokines. So, we incubated control acini with TNF- alone and with both TNF- and INF- and then occludin was identified in these samples.
  • 22. Control Patient A B IC IC d a a a Patient C d a IC Patient D TNF- immunolocalization in acini, ducts and inflammatory cell infiltrates of control and SS-patients ARTHRITIS & RHEUMATISM 62:1280–1289, 2010
  • 23. C L B L A Control TNF- 10ng/ml TNF- 30ng/ml L D L TNF- + IFN- 20 ng/ml Effect of TNF- and/or IFN- on acinus and localization of occludin In all experimental conditions we observed re-distribution of occludin ARTHRITIS & RHEUMATISM 62:1280–1289, 2010
  • 24. IFN- IFN- and TNF- (Sci STKE.2006 (316):pe1 Review) APICAL What cytokine induced mechanisms cause TJ Disorganization?
  • 25. STX3 VAMP8 SNAP-23 STX3 VAMP8 STX4 STX4 and SNAP-23 VAMP8 VAMP8 STX4 and SNAP-23 VAMP8 Munc18 Rab3D Synaptotagmin GTP Syntaxin 4 SNAP-23 Ca2+ Ca2+ Ca2+ NSF α-SNAP Mature secretory granule Plasma membrane 1. Rab GTPases 2. SNARE proteins 3. NSF/αSNAP 4. Modulating proteins SNARE proteins in control acinar cells SNARE proteins are receptors for membrane fusion How do changes in cell polarity affect the localization of proteins involved in regulated exocytosis?
  • 26. In control acini, VAMP8 was localized in the apical secretory granules and the nuclei were localized in the basal region of acinar cells. In SS-patients, VAMP8 was observed all over the cytoplasm and the nuclei had lost their polarity. apical C Patient VAMP8/nuclei apical D apical B apical A Control Re-distribution of VAMP8 and loss of nuclear polarity in acinar cells from MSG of SS-patients ARTHRITIS & RHEUMATISM 63:3126–3135, 2011
  • 27. STX3, in control acini is located in the apical cytoplasm, while in SS-patients it is observed in all over the cytoplasm. STX4, in control acini, is mainly localized next to the basolateral plasma membrane and to a lesser extent to the apical plasma membrane. In SS-patients STX-4 is mainly localized in the basal plasma membrane. SNAP-23, in control acini, is mainly localized in the plasma membrane, while in SS-patients, it has lower immunoreactivity, particularly at the apical and lateral plasma membranes. Subcellular localization of STX3, STX4, and SNAP-23 in SS-patients Journal of Autoimmunity 39: 83-92, 2012 PatientControl SNAP-23E apical A STX3 apical B F DC STX4
  • 28. C Patient apical BA apical Control Control apical B D basal Patient apical Considering the re-distribution of SNARE proteins we were interested in determining if SNARE complexes localized ectopically were formed 1. In acinar cells of SS patients there was a significant increase in the levels of SNARE complexes for VAMP8 and STX4. 2. In controls, VAMP8 localized to the apical cytoplasm of acinar cells, whereas in SS-patients VAMP8 was observed all over the cytoplasm. Formation of SNARE-complexes in vivo 3. In controls, STX4 localized in all the plasma membrane, in SS-patients STX4 co-localized with VAMP8, mainly in basolateral plasma membrane Journal of Autoimmunity 39: 83-92, 2012 Control 32 100 Monomeric STX4 P25ºC C25ºC 100 18 kDa Monomeric VAMP-8 P100ºC C100ºC P25ºC C25ºC kDa STX4 SNARE Complex VAMP8 SNARE Complex C100ºC P100ºC Patient SNARE COMPLEXES ARE STABLE AT 25ºC
  • 29. Could these ectopic SNARE complexes participate in the basal exocytosis of mucins?
  • 30. Patient Control D m S ECM S m S A MUC7/LAMININ B DIC C MUC7/LAMININ/DIC E F Presence of secreted MUC7 in the extracellular matrix of MSG from SS-patients In controls, MUC7 localized in the cytoplasm of acinar cells. In SS patients MUC7 maintained its localization in the acinar cells, but was also detected atypically in the ECM. The Laminin a component of the basal lamina marked the boundary of the acinus. Journal of Autoimmunity 39: 83-92, 2012
  • 31. Aberrant exocytosis of MUC5B and MUC7 Controls SS-Patients BASAL APICAL LATERAL VAMP8 STX3 SNAP-23 STX4 Rab3D Occludin Claudin-4 Claudin-3 ZO-1 TJ Basal Lamina Summary Nat Rev Rheumatol 21:186, 2012 J Autoimmunity 42: 7-18,2013
  • 32. So, we wanted to determine whether exogenous mucins were able to induce the expression of pro-inflammatory cytokines in cultured human salivary cells (HSG). These results allowed us to conclude that the loss of acinar cell polarity leads to ectopic exocytosis, which could explain the oral dryness in these patients.
  • 34. Relative mRNA levels of pro-inflammatory cytokines in HSG cells stimulated with mucins A significant increase (*) in relative mRNA levels of pro-inflammatory cytokines was observed. Differences found for BAFF were not significant. ……..So we wondered……….. 0 0.5 1 1.5 2 2.5 3 3.5 4 4.5 5 CXCL-8 TNF-α IFN-α IFN-β IL-6 IL-1β BAFF Cytokine/h18S(Relativeexpressionratio) 0µM 0.001 µM 0.01 µM 0.1 µM 0.2µM 0.4 µM * * * * * * * ** * BSM Barrera et al, under revision
  • 35. Are the mucin’s sugar residues involved in the induction of these cytokines?
  • 36. Effect of purified MUC5B and Sulfo-Lewis residues in the relative expression levels of cytokines in HSG cells Sulfo-Lewis showed a comparable response to purified MUC5B. These results allowed us to postulate that the mucins might be recognized by their sugar residues. Sulfo Lewis : SO3-Galβ1-3GlcNAc is a sulfated disaccharide presents in MUC5B MUC5B Sulfo-Le BSM * * * * * * * * * * * 0 0,5 1 1,5 2 2,5 3 3,5 4 4,5 5 0 0.005 0.015 21.6 54 0.4 µM Cytokine/h18S(Relativeexpressionratio) IL-6 TNF-α IL-1 Barrera et al, manuscript under review
  • 37. Ligands containing sugar residues can bind Toll like receptors, such as TLR4. We used the lipopolysaccharide (LPS), a ligand of TLR4, to induce expression of cytokines. Then, we compared the LPS- induced cytokine profile with the mucin-induced profile.
  • 38. Comparison between relative mRNA levels of pro-inflammatory cytokines in HSG cells stimulated with LPS or mucins Stimulation of HSG cells with TLR4 ligand induced the expression of IL-6 and TNF-α in a similar manner to stimulation with mucins. LPS BSM * * * * * * 0 0.5 1 1.5 2 2.5 3 3.5 4 4.5 0 0.01 0.1 0.2 0.4 µM Cytokine/h18S(Relativeexpressionratio) IL-6 TNF-α Barrera et al, manuscript under review
  • 39. The role of TLR4 in cytokine induction was evaluated using TBX2, a peptide that specifically inhibits TIRAP binding to TLR4. The TNF- and IL-6 expression were determined. TBX2: GKMADWFRQTLLKKPKKRPNSPESTLQLRDATPGGAIVS TBX2 Modified of Cytokine 42 (2008) 145–151Modified of JBiotechnology 129 (2007) 555–564 Dominant-negative domain TIRAPTBX2 TLR4 MyD88 Molecular modeling and prediction of protein– protein interaction. TLR4, TIRAP, MyD88 and TBX2 are shown in ribbon representation.
  • 40. Relative mRNA levels of TNF-α and IL-6 in HSG cells treated with a TIRAP inhibitory peptide of TLR4 TBX2 selectively inhibited the production of pro-inflammatory cytokines under the induction of mucins or LPS. This inhibition might have been mediated by the disruption of the recruitment of downstream effector molecules. Mucins induced the expression of pro-inflammatory cytokines via TLR4. TNF-α # * # * 0 1 2 3 4 5 6 UT TBX2 LPS TBX2/LPS BSM TBX2/BSM TNF-α/h18S(Relativeexpressionratio) IL-6 # * # * 0 0.5 1 1.5 2 2.5 3 3.5 4 4.5 UT TBX2 LPS TBX2/LPS BSM TBX2/BSM IL-6/h18S(Relativeexpressionratio) Barrera et al, manuscript under review
  • 41. anti-hTLR4-IgG Modified of Cytokine 42 (2008) 145–151 To confirm the involvement of TLR4, we used blocking antibodies against TLR4 and measured TNF- and IL-6 expression in LPS-treated or mucin-treated cells.
  • 42. Relative IL-6 mRNA levels in HSG cells treated with a TLR4-blocking antibody The specific antibody against TLR4 inhibited the expression of cytokines. These results demonstrated that mucins induced the expression of pro-inflammatory cytokines via a TLR4 mediated mechanism. * * #* * # 0 0.5 1 1.5 2 2.5 3 3.5 4 IL-6/h18S(Relativeexpressionratio) Barrera et al, manuscript under review
  • 43. In HSG cells, exogenous MUC5B and Sulfo-Lewis can induce, via TLR4, the mRNA expression of pro-inflammatory cytokines. However, we aren’t discarding the possibility that galectins and TIM family receptors might also play a role. A similar response might be observed in the salivary gland extracellular matrix of SS patients, where the ectopically secreted mucins may promote the infiltration of inflammatory cells, a hallmark in the pathogenesis of the disease. CONCLUSIONS
  • 44. Concluding Remarks Cellular interactions are essential for the maintenance of morphological and functional homeostasis of salivary epithelia. An important element involved in the development of autoimmunity is the loss of the protective function of mucosal barriers by disruption of tight junctions. The potentially pathogenic ectopic secretion of mucins and other factors into the ECM “may be the initial step in the genesis of the disease”.
  • 45. Colaborators National Sergio Aguilera Claudio Molina Sergio González Cecilia Alliende Marcela Hermoso Ulises Urzúa Andrew Quest Lisette Leyton Cecilia Leyton Internacional Juan Manuel Anaya Enno Veerman Ulla Mandel Bruce Baum Henrik Clausen Inka Brockhausen FONDECYT Our Students Paola Pérez Eduardo Goicovich Yoon-Jeoung Kwon Patricia Ewert Marianela Sánchez María José Barrera Rodrigo Pinto Mónica Brito Juan Cortés Isabel Castro Verónica Bahamondes Hsiao Hsin Sung Camilo Tapia Denisse Sepúlveda Hery Urra José Velozo Sebastián Indo Katherine Bravo Camilo Tapia Sebastián Puga Carolina Lagos` Patricia Carvajal Nicolás Albornoz A heartfelt gratitude to our Patients
  • 46. Model of the changes in assembly of type I-HD in LSG from SS patients González S et al ARTHRITIS & RHEUMATISM 63, 2011, 1106–1115