SlideShare une entreprise Scribd logo
1  sur  30
Télécharger pour lire hors ligne
Function of NS2B for NS3
   protease activation of
Japanese encephalitis virus

               Mr.Chakard Chalayut
     Advisor: Assist.Prof Gerd Katzenmeier
         Laboratory of Molecular virology
    Institute of Molecular Biology & Genetics
Japanese Encephalitis Virus
          (JEV)
  Culex tritaeniorhynchus.




Source: fehd.gov.hk          Source: news.bbc.co.uk
Japanese Encephalitis Virus
          (JEV)




   Source : vietnammedicalpractice.com
Japanese Encephalitis Virus
           (JEV)

  50,000 Cases
  10,000
30% fatality rate
 Source: medwork84.com



                         Source: cdc.gov
Prevention and treatment of
          JEV disease


       Drug                No drug exist


Vaccine development       Available vaccine


                      Elimination of mosquitoes
 Mosquitoes control        breeding places
Molecular biology of Japanese Encephalitis Virus




               Source : molecular-virology.uni-hd.de
The NS2B
  • 130 aa                         Hypothetical model
  • activating domain              NS2B-NS3 complex
      central hydrophilic region
      (Falgout et al, 1993)
  • 3 membrane spanning parts

     hydrophobicity plot



                                        ฺBrinkworth et al, 1999




51 DMWLERAADISWEMDAAITGSSRRLDVKLDDDGDFHLIDDPGVP 95
The NS3

                                 Protease

                                  NTPase


                             •Chymotrypsin-like fold
                             2-β barrel Helicase
                                 RNA domains
                             •Inactive alone
Theoretical model from PDB
                             •Enzyme’s pocket is small
            2I84
The NS3 protease
       Complexation with NS2B cofactor

        •NS3 serine protease
        domain 20 of thechange pocket
                       kDa enzyme
            conformational
            alteration
        •catalytic residues binding site
            additional substrate His51,
        Asp75, Ser135
• The result shown the slightly differences inby
  Some physico-chemical properties shared
  all the proteases.
  biochemical properties.
Homology Modelling of
   NS3 protease
Homology Modelling of
   NS3 protease



WNV      JEV       DEN
• The NS2B-NS3 can adopt two distinctfit mechanism.
  NS2B-NS3 WNV shown the induced conformation.
• Two component of protease has a substrate
  specificity.
• Two component of protease has a unique
  activation mechanism.
• The NS3 protease share the similar
  structure in the Flavivirus group but are
  different in cofactor binding.
• To investigate the function determination in
  the JEV NS2B for the activation of NS3
  protease.
Method 1.and mutation forms
Expression and purification of deleted
               of NS2B-NS3 protease

        Full length NS2B and NS3 protease

 PCR to amply deleted and mutation forms of NS2B

               Clone into vector

            Expression and Purification

           SDS-PAGE and Western Blot
Method 1.
Result




Lane 1- 5 = Washing Fraction with 100 mM Imidazole
Lane 6 -10 = Eluted Fraction with 400 mM Imidazole
Method II
Trans-cleavage of fluorogenie peptide substrate


           NS2B-NS3 protease

        Incubate with GKR-AMC


   Measured the florescence Change
Result
Method III
   Molecular Modelling of a JEV NS2B-NS3 complex

         JEV NS2B and NS3 protease protein

      Based on WNV crystallographic structure


Perform the structural modelling by using Swiss modeling
           workstation & MEDock program
Result
Result




Lane 1- 5 = Washing Fraction with 100 mM Imidazole
Lane 6 -10 = Eluted Fraction with 400 mM Imidazole
Discussion
• Ser46 and Ile60 are essential region of JEV
  NS2B for activation of NS3 protease.
• Alanine substitution demonstrate the
  functional conformation of Trp53, Glu55 and
  Arg56 in JEV NS2B for the cleavage ability
  of NS2B-NS3 protease.
• Residues Ala67 to Asp76 of JEV NS2B
  suggested to provide the additional β-
  strands to stabilize the fold of NS3 protease.
Discussion
• Residues Lys78 to Leu87 of JEV NS2B may
  involved in the formation of the active site in
  the NS2B-NS3 protease.
• Due to the substrate specificity of the
  NS2B-NS3 protease.
  • Can we make a very specific anti-viral drug
    to Flavivirus ?


 The pan-Flavivirus NS3 protease drugs may
     be developed for Flaviviral diseases.
Thank you for your attention.

Contenu connexe

Tendances

P gem3 z example of puc vector
P gem3 z example of puc vectorP gem3 z example of puc vector
P gem3 z example of puc vectormicrobiology Notes
 
CDNA Library preparation. ppt for Jamil sir
CDNA Library preparation. ppt for Jamil sirCDNA Library preparation. ppt for Jamil sir
CDNA Library preparation. ppt for Jamil sirNushrat Jahan
 
Lectut btn-202-ppt-l19. construction of dna libraries
Lectut btn-202-ppt-l19. construction of dna librariesLectut btn-202-ppt-l19. construction of dna libraries
Lectut btn-202-ppt-l19. construction of dna librariesRishabh Jain
 
Gene Subtraction
Gene SubtractionGene Subtraction
Gene SubtractionHARIS.P
 
POLYMERASE CHAIN REACTION (PCR)
POLYMERASE CHAIN REACTION (PCR)POLYMERASE CHAIN REACTION (PCR)
POLYMERASE CHAIN REACTION (PCR)YESANNA
 
DNA cloning
DNA cloningDNA cloning
DNA cloningDivya S
 
TAPPING THE RNA WORLD FOR THERAPEUTICS
TAPPING THE RNA WORLD FOR THERAPEUTICSTAPPING THE RNA WORLD FOR THERAPEUTICS
TAPPING THE RNA WORLD FOR THERAPEUTICSHasnat Tariq
 
12th Biology Biotechnology Principles and Processes Part 4
12th Biology Biotechnology Principles and Processes Part 412th Biology Biotechnology Principles and Processes Part 4
12th Biology Biotechnology Principles and Processes Part 4Vista's Learning
 
Maxam gilbert sequencing method
Maxam gilbert sequencing methodMaxam gilbert sequencing method
Maxam gilbert sequencing methodBabar khan
 
Polymerase Chain Reaction
Polymerase Chain ReactionPolymerase Chain Reaction
Polymerase Chain Reactionsara_abudahab
 
The complete guide to learn gene cloning
The complete guide to learn gene cloningThe complete guide to learn gene cloning
The complete guide to learn gene cloningCreative Biogene
 
RNA & Reverse Transcription by Farah Arain
RNA & Reverse Transcription by Farah ArainRNA & Reverse Transcription by Farah Arain
RNA & Reverse Transcription by Farah ArainNadirAliBhangar
 
Introduction to RDT methods in genetic engineering
Introduction to RDT methods in genetic engineeringIntroduction to RDT methods in genetic engineering
Introduction to RDT methods in genetic engineeringCollege
 

Tendances (20)

P gem3 z example of puc vector
P gem3 z example of puc vectorP gem3 z example of puc vector
P gem3 z example of puc vector
 
CDNA Library preparation. ppt for Jamil sir
CDNA Library preparation. ppt for Jamil sirCDNA Library preparation. ppt for Jamil sir
CDNA Library preparation. ppt for Jamil sir
 
Gene sequencing
Gene sequencingGene sequencing
Gene sequencing
 
Lectut btn-202-ppt-l19. construction of dna libraries
Lectut btn-202-ppt-l19. construction of dna librariesLectut btn-202-ppt-l19. construction of dna libraries
Lectut btn-202-ppt-l19. construction of dna libraries
 
Gene Subtraction
Gene SubtractionGene Subtraction
Gene Subtraction
 
POLYMERASE CHAIN REACTION (PCR)
POLYMERASE CHAIN REACTION (PCR)POLYMERASE CHAIN REACTION (PCR)
POLYMERASE CHAIN REACTION (PCR)
 
Reverse Transcription
Reverse TranscriptionReverse Transcription
Reverse Transcription
 
DNA cloning
DNA cloningDNA cloning
DNA cloning
 
Emulsion pcr
Emulsion pcrEmulsion pcr
Emulsion pcr
 
Ligase enzyme
Ligase enzyme Ligase enzyme
Ligase enzyme
 
Dna sequencing and its types
Dna sequencing and its typesDna sequencing and its types
Dna sequencing and its types
 
TAPPING THE RNA WORLD FOR THERAPEUTICS
TAPPING THE RNA WORLD FOR THERAPEUTICSTAPPING THE RNA WORLD FOR THERAPEUTICS
TAPPING THE RNA WORLD FOR THERAPEUTICS
 
Restriction Enzymes
Restriction Enzymes Restriction Enzymes
Restriction Enzymes
 
12th Biology Biotechnology Principles and Processes Part 4
12th Biology Biotechnology Principles and Processes Part 412th Biology Biotechnology Principles and Processes Part 4
12th Biology Biotechnology Principles and Processes Part 4
 
Maxam gilbert sequencing method
Maxam gilbert sequencing methodMaxam gilbert sequencing method
Maxam gilbert sequencing method
 
Polymerase Chain Reaction
Polymerase Chain ReactionPolymerase Chain Reaction
Polymerase Chain Reaction
 
The complete guide to learn gene cloning
The complete guide to learn gene cloningThe complete guide to learn gene cloning
The complete guide to learn gene cloning
 
RNA & Reverse Transcription by Farah Arain
RNA & Reverse Transcription by Farah ArainRNA & Reverse Transcription by Farah Arain
RNA & Reverse Transcription by Farah Arain
 
Dna ligase
Dna ligaseDna ligase
Dna ligase
 
Introduction to RDT methods in genetic engineering
Introduction to RDT methods in genetic engineeringIntroduction to RDT methods in genetic engineering
Introduction to RDT methods in genetic engineering
 

En vedette

National Workshop on ns-3
National Workshop on ns-3National Workshop on ns-3
National Workshop on ns-3Vijander Singh
 
Building Topology in NS3
Building Topology in NS3Building Topology in NS3
Building Topology in NS3Rahul Hada
 
Tutorial ns 3-tutorial-slides
Tutorial ns 3-tutorial-slidesTutorial ns 3-tutorial-slides
Tutorial ns 3-tutorial-slidesVinayagam D
 
Ns3 implementation wifi
Ns3 implementation wifiNs3 implementation wifi
Ns3 implementation wifiSalah Amean
 

En vedette (8)

NS3 Tech Talk
NS3 Tech TalkNS3 Tech Talk
NS3 Tech Talk
 
National Workshop on ns-3
National Workshop on ns-3National Workshop on ns-3
National Workshop on ns-3
 
Seminar 2
Seminar 2Seminar 2
Seminar 2
 
NS3 Overview
NS3 OverviewNS3 Overview
NS3 Overview
 
Building Topology in NS3
Building Topology in NS3Building Topology in NS3
Building Topology in NS3
 
ns-3 Tutorial
ns-3 Tutorialns-3 Tutorial
ns-3 Tutorial
 
Tutorial ns 3-tutorial-slides
Tutorial ns 3-tutorial-slidesTutorial ns 3-tutorial-slides
Tutorial ns 3-tutorial-slides
 
Ns3 implementation wifi
Ns3 implementation wifiNs3 implementation wifi
Ns3 implementation wifi
 

Similaire à Seminar Final.Key

Diversity and distribution of nicotinic acetylcholine receptors in the locus ...
Diversity and distribution of nicotinic acetylcholine receptors in the locus ...Diversity and distribution of nicotinic acetylcholine receptors in the locus ...
Diversity and distribution of nicotinic acetylcholine receptors in the locus ...Georgi Daskalov
 
Debarko banerji sacnas ppresentation
Debarko banerji   sacnas ppresentationDebarko banerji   sacnas ppresentation
Debarko banerji sacnas ppresentationDebarko Banerji
 
Gene editing.pdf
Gene editing.pdfGene editing.pdf
Gene editing.pdfYasra3
 
Effects of modifying backbone flexibility in α3 subunits of nicotinic acetylc...
Effects of modifying backbone flexibility in α3 subunits of nicotinic acetylc...Effects of modifying backbone flexibility in α3 subunits of nicotinic acetylc...
Effects of modifying backbone flexibility in α3 subunits of nicotinic acetylc...Victoria Dorich
 
Isothermal Nucleic Acid Amplification Techniques
Isothermal Nucleic Acid Amplification TechniquesIsothermal Nucleic Acid Amplification Techniques
Isothermal Nucleic Acid Amplification TechniquesAref Farokhi Fard
 
P68 RNA helicase unwinds the human let-7 microRNA precursor duplex and is req...
P68 RNA helicase unwinds the human let-7 microRNA precursor duplex and is req...P68 RNA helicase unwinds the human let-7 microRNA precursor duplex and is req...
P68 RNA helicase unwinds the human let-7 microRNA precursor duplex and is req...David W. Salzman
 
PCR applications.pptx
PCR applications.pptxPCR applications.pptx
PCR applications.pptxB. BHASKAR
 
Yishun Junior College_Lou Wei Hao Darren_ SSEF report_BC020
Yishun Junior College_Lou Wei Hao Darren_ SSEF report_BC020Yishun Junior College_Lou Wei Hao Darren_ SSEF report_BC020
Yishun Junior College_Lou Wei Hao Darren_ SSEF report_BC020Darren Wei Hao Lou
 
Next generation sequencing
Next generation sequencingNext generation sequencing
Next generation sequencingLINUS CORNERY
 
Blotting techniques
Blotting techniquesBlotting techniques
Blotting techniquesAlex Chris
 
DNA damage repair Neil3 gene Knockout in MOLT-4
DNA damage repair Neil3 gene Knockout in MOLT-4DNA damage repair Neil3 gene Knockout in MOLT-4
DNA damage repair Neil3 gene Knockout in MOLT-4iosrjce
 
Genome editing in Plants with crispr/cas9
Genome editing in Plants with crispr/cas9Genome editing in Plants with crispr/cas9
Genome editing in Plants with crispr/cas9Shalu Jain, PhD
 
EFFECT OF RESVERETROL ON HUMAN BREAST CANCER (MCF-7) CELL LINE
EFFECT OF RESVERETROL ON HUMAN BREAST CANCER (MCF-7) CELL LINEEFFECT OF RESVERETROL ON HUMAN BREAST CANCER (MCF-7) CELL LINE
EFFECT OF RESVERETROL ON HUMAN BREAST CANCER (MCF-7) CELL LINEAbhishek Banerjee
 

Similaire à Seminar Final.Key (20)

Flavivirus Group meeting
Flavivirus Group meetingFlavivirus Group meeting
Flavivirus Group meeting
 
Diversity and distribution of nicotinic acetylcholine receptors in the locus ...
Diversity and distribution of nicotinic acetylcholine receptors in the locus ...Diversity and distribution of nicotinic acetylcholine receptors in the locus ...
Diversity and distribution of nicotinic acetylcholine receptors in the locus ...
 
Evaluation 3
Evaluation 3Evaluation 3
Evaluation 3
 
Debarko banerji sacnas ppresentation
Debarko banerji   sacnas ppresentationDebarko banerji   sacnas ppresentation
Debarko banerji sacnas ppresentation
 
IGEM poster
IGEM posterIGEM poster
IGEM poster
 
Gene editing.pdf
Gene editing.pdfGene editing.pdf
Gene editing.pdf
 
microarray_paper
microarray_papermicroarray_paper
microarray_paper
 
Effects of modifying backbone flexibility in α3 subunits of nicotinic acetylc...
Effects of modifying backbone flexibility in α3 subunits of nicotinic acetylc...Effects of modifying backbone flexibility in α3 subunits of nicotinic acetylc...
Effects of modifying backbone flexibility in α3 subunits of nicotinic acetylc...
 
Isothermal Nucleic Acid Amplification Techniques
Isothermal Nucleic Acid Amplification TechniquesIsothermal Nucleic Acid Amplification Techniques
Isothermal Nucleic Acid Amplification Techniques
 
P68 RNA helicase unwinds the human let-7 microRNA precursor duplex and is req...
P68 RNA helicase unwinds the human let-7 microRNA precursor duplex and is req...P68 RNA helicase unwinds the human let-7 microRNA precursor duplex and is req...
P68 RNA helicase unwinds the human let-7 microRNA precursor duplex and is req...
 
PCR applications.pptx
PCR applications.pptxPCR applications.pptx
PCR applications.pptx
 
Yishun Junior College_Lou Wei Hao Darren_ SSEF report_BC020
Yishun Junior College_Lou Wei Hao Darren_ SSEF report_BC020Yishun Junior College_Lou Wei Hao Darren_ SSEF report_BC020
Yishun Junior College_Lou Wei Hao Darren_ SSEF report_BC020
 
Next generation sequencing
Next generation sequencingNext generation sequencing
Next generation sequencing
 
Blotting techniques
Blotting techniquesBlotting techniques
Blotting techniques
 
DNA damage repair Neil3 gene Knockout in MOLT-4
DNA damage repair Neil3 gene Knockout in MOLT-4DNA damage repair Neil3 gene Knockout in MOLT-4
DNA damage repair Neil3 gene Knockout in MOLT-4
 
Work presentation
Work presentationWork presentation
Work presentation
 
Pcr & gel
Pcr & gelPcr & gel
Pcr & gel
 
Genome editing in Plants with crispr/cas9
Genome editing in Plants with crispr/cas9Genome editing in Plants with crispr/cas9
Genome editing in Plants with crispr/cas9
 
projekt final
projekt finalprojekt final
projekt final
 
EFFECT OF RESVERETROL ON HUMAN BREAST CANCER (MCF-7) CELL LINE
EFFECT OF RESVERETROL ON HUMAN BREAST CANCER (MCF-7) CELL LINEEFFECT OF RESVERETROL ON HUMAN BREAST CANCER (MCF-7) CELL LINE
EFFECT OF RESVERETROL ON HUMAN BREAST CANCER (MCF-7) CELL LINE
 

Plus de Chakard Chalayut

Data and personality introducing psychologic
Data and personality introducing psychologic Data and personality introducing psychologic
Data and personality introducing psychologic Chakard Chalayut
 
The power of user psychology and behaviour
The power of user psychology and behaviourThe power of user psychology and behaviour
The power of user psychology and behaviourChakard Chalayut
 
Innovation-Marketing for Sustainability
Innovation-Marketing for Sustainability Innovation-Marketing for Sustainability
Innovation-Marketing for Sustainability Chakard Chalayut
 
Art & Science of Viral Video in Digital Marketing
Art & Science of Viral Video in Digital Marketing Art & Science of Viral Video in Digital Marketing
Art & Science of Viral Video in Digital Marketing Chakard Chalayut
 
Marketing Trend from Global
Marketing Trend from Global Marketing Trend from Global
Marketing Trend from Global Chakard Chalayut
 
about SXSW 2018 in AI topic
about SXSW 2018 in AI topicabout SXSW 2018 in AI topic
about SXSW 2018 in AI topicChakard Chalayut
 
Total Experience Journey Management
Total Experience Journey Management Total Experience Journey Management
Total Experience Journey Management Chakard Chalayut
 
Can we predict human future with data
Can we predict human future with dataCan we predict human future with data
Can we predict human future with dataChakard Chalayut
 
End of content era, Long live the Human Experience
End of content era, Long live the Human Experience End of content era, Long live the Human Experience
End of content era, Long live the Human Experience Chakard Chalayut
 
What da heck is Digital marketing?
What da heck is Digital marketing?What da heck is Digital marketing?
What da heck is Digital marketing?Chakard Chalayut
 
Social Media Marketing For Biotech and Pharmaceutical Industry
Social Media Marketing For Biotech and Pharmaceutical Industry Social Media Marketing For Biotech and Pharmaceutical Industry
Social Media Marketing For Biotech and Pharmaceutical Industry Chakard Chalayut
 
Social Media for non profit
Social Media for non profitSocial Media for non profit
Social Media for non profitChakard Chalayut
 
How To Get The Girlfriend Barcampbangkok2
How To Get The Girlfriend Barcampbangkok2How To Get The Girlfriend Barcampbangkok2
How To Get The Girlfriend Barcampbangkok2Chakard Chalayut
 
How to participate in Barcamp
How to participate in BarcampHow to participate in Barcamp
How to participate in BarcampChakard Chalayut
 

Plus de Chakard Chalayut (20)

Data and personality introducing psychologic
Data and personality introducing psychologic Data and personality introducing psychologic
Data and personality introducing psychologic
 
The power of user psychology and behaviour
The power of user psychology and behaviourThe power of user psychology and behaviour
The power of user psychology and behaviour
 
Innovation-Marketing for Sustainability
Innovation-Marketing for Sustainability Innovation-Marketing for Sustainability
Innovation-Marketing for Sustainability
 
Art & Science of Viral Video in Digital Marketing
Art & Science of Viral Video in Digital Marketing Art & Science of Viral Video in Digital Marketing
Art & Science of Viral Video in Digital Marketing
 
Marketing Trend from Global
Marketing Trend from Global Marketing Trend from Global
Marketing Trend from Global
 
Digital media 2018
Digital media 2018Digital media 2018
Digital media 2018
 
about SXSW 2018 in AI topic
about SXSW 2018 in AI topicabout SXSW 2018 in AI topic
about SXSW 2018 in AI topic
 
World of chaos
World of chaosWorld of chaos
World of chaos
 
Total Experience Journey Management
Total Experience Journey Management Total Experience Journey Management
Total Experience Journey Management
 
Can we predict human future with data
Can we predict human future with dataCan we predict human future with data
Can we predict human future with data
 
End of content era, Long live the Human Experience
End of content era, Long live the Human Experience End of content era, Long live the Human Experience
End of content era, Long live the Human Experience
 
What da heck is Digital marketing?
What da heck is Digital marketing?What da heck is Digital marketing?
What da heck is Digital marketing?
 
Scratch 2 Social Media
Scratch 2 Social Media Scratch 2 Social Media
Scratch 2 Social Media
 
Scratch to Social Media
Scratch to Social Media Scratch to Social Media
Scratch to Social Media
 
Social Media Marketing For Biotech and Pharmaceutical Industry
Social Media Marketing For Biotech and Pharmaceutical Industry Social Media Marketing For Biotech and Pharmaceutical Industry
Social Media Marketing For Biotech and Pharmaceutical Industry
 
Social Media for non profit
Social Media for non profitSocial Media for non profit
Social Media for non profit
 
Social media CRM
Social media CRMSocial media CRM
Social media CRM
 
Thinkcamp
ThinkcampThinkcamp
Thinkcamp
 
How To Get The Girlfriend Barcampbangkok2
How To Get The Girlfriend Barcampbangkok2How To Get The Girlfriend Barcampbangkok2
How To Get The Girlfriend Barcampbangkok2
 
How to participate in Barcamp
How to participate in BarcampHow to participate in Barcamp
How to participate in Barcamp
 

Dernier

DBX First Quarter 2024 Investor Presentation
DBX First Quarter 2024 Investor PresentationDBX First Quarter 2024 Investor Presentation
DBX First Quarter 2024 Investor PresentationDropbox
 
Finding Java's Hidden Performance Traps @ DevoxxUK 2024
Finding Java's Hidden Performance Traps @ DevoxxUK 2024Finding Java's Hidden Performance Traps @ DevoxxUK 2024
Finding Java's Hidden Performance Traps @ DevoxxUK 2024Victor Rentea
 
Modular Monolith - a Practical Alternative to Microservices @ Devoxx UK 2024
Modular Monolith - a Practical Alternative to Microservices @ Devoxx UK 2024Modular Monolith - a Practical Alternative to Microservices @ Devoxx UK 2024
Modular Monolith - a Practical Alternative to Microservices @ Devoxx UK 2024Victor Rentea
 
Apidays New York 2024 - The Good, the Bad and the Governed by David O'Neill, ...
Apidays New York 2024 - The Good, the Bad and the Governed by David O'Neill, ...Apidays New York 2024 - The Good, the Bad and the Governed by David O'Neill, ...
Apidays New York 2024 - The Good, the Bad and the Governed by David O'Neill, ...apidays
 
Strategize a Smooth Tenant-to-tenant Migration and Copilot Takeoff
Strategize a Smooth Tenant-to-tenant Migration and Copilot TakeoffStrategize a Smooth Tenant-to-tenant Migration and Copilot Takeoff
Strategize a Smooth Tenant-to-tenant Migration and Copilot Takeoffsammart93
 
FWD Group - Insurer Innovation Award 2024
FWD Group - Insurer Innovation Award 2024FWD Group - Insurer Innovation Award 2024
FWD Group - Insurer Innovation Award 2024The Digital Insurer
 
MS Copilot expands with MS Graph connectors
MS Copilot expands with MS Graph connectorsMS Copilot expands with MS Graph connectors
MS Copilot expands with MS Graph connectorsNanddeep Nachan
 
Repurposing LNG terminals for Hydrogen Ammonia: Feasibility and Cost Saving
Repurposing LNG terminals for Hydrogen Ammonia: Feasibility and Cost SavingRepurposing LNG terminals for Hydrogen Ammonia: Feasibility and Cost Saving
Repurposing LNG terminals for Hydrogen Ammonia: Feasibility and Cost SavingEdi Saputra
 
ProductAnonymous-April2024-WinProductDiscovery-MelissaKlemke
ProductAnonymous-April2024-WinProductDiscovery-MelissaKlemkeProductAnonymous-April2024-WinProductDiscovery-MelissaKlemke
ProductAnonymous-April2024-WinProductDiscovery-MelissaKlemkeProduct Anonymous
 
Exploring Multimodal Embeddings with Milvus
Exploring Multimodal Embeddings with MilvusExploring Multimodal Embeddings with Milvus
Exploring Multimodal Embeddings with MilvusZilliz
 
How to Troubleshoot Apps for the Modern Connected Worker
How to Troubleshoot Apps for the Modern Connected WorkerHow to Troubleshoot Apps for the Modern Connected Worker
How to Troubleshoot Apps for the Modern Connected WorkerThousandEyes
 
AWS Community Day CPH - Three problems of Terraform
AWS Community Day CPH - Three problems of TerraformAWS Community Day CPH - Three problems of Terraform
AWS Community Day CPH - Three problems of TerraformAndrey Devyatkin
 
Six Myths about Ontologies: The Basics of Formal Ontology
Six Myths about Ontologies: The Basics of Formal OntologySix Myths about Ontologies: The Basics of Formal Ontology
Six Myths about Ontologies: The Basics of Formal Ontologyjohnbeverley2021
 
Apidays New York 2024 - APIs in 2030: The Risk of Technological Sleepwalk by ...
Apidays New York 2024 - APIs in 2030: The Risk of Technological Sleepwalk by ...Apidays New York 2024 - APIs in 2030: The Risk of Technological Sleepwalk by ...
Apidays New York 2024 - APIs in 2030: The Risk of Technological Sleepwalk by ...apidays
 
Web Form Automation for Bonterra Impact Management (fka Social Solutions Apri...
Web Form Automation for Bonterra Impact Management (fka Social Solutions Apri...Web Form Automation for Bonterra Impact Management (fka Social Solutions Apri...
Web Form Automation for Bonterra Impact Management (fka Social Solutions Apri...Jeffrey Haguewood
 
[BuildWithAI] Introduction to Gemini.pdf
[BuildWithAI] Introduction to Gemini.pdf[BuildWithAI] Introduction to Gemini.pdf
[BuildWithAI] Introduction to Gemini.pdfSandro Moreira
 
DEV meet-up UiPath Document Understanding May 7 2024 Amsterdam
DEV meet-up UiPath Document Understanding May 7 2024 AmsterdamDEV meet-up UiPath Document Understanding May 7 2024 Amsterdam
DEV meet-up UiPath Document Understanding May 7 2024 AmsterdamUiPathCommunity
 
Platformless Horizons for Digital Adaptability
Platformless Horizons for Digital AdaptabilityPlatformless Horizons for Digital Adaptability
Platformless Horizons for Digital AdaptabilityWSO2
 
Artificial Intelligence Chap.5 : Uncertainty
Artificial Intelligence Chap.5 : UncertaintyArtificial Intelligence Chap.5 : Uncertainty
Artificial Intelligence Chap.5 : UncertaintyKhushali Kathiriya
 

Dernier (20)

DBX First Quarter 2024 Investor Presentation
DBX First Quarter 2024 Investor PresentationDBX First Quarter 2024 Investor Presentation
DBX First Quarter 2024 Investor Presentation
 
Finding Java's Hidden Performance Traps @ DevoxxUK 2024
Finding Java's Hidden Performance Traps @ DevoxxUK 2024Finding Java's Hidden Performance Traps @ DevoxxUK 2024
Finding Java's Hidden Performance Traps @ DevoxxUK 2024
 
Modular Monolith - a Practical Alternative to Microservices @ Devoxx UK 2024
Modular Monolith - a Practical Alternative to Microservices @ Devoxx UK 2024Modular Monolith - a Practical Alternative to Microservices @ Devoxx UK 2024
Modular Monolith - a Practical Alternative to Microservices @ Devoxx UK 2024
 
Apidays New York 2024 - The Good, the Bad and the Governed by David O'Neill, ...
Apidays New York 2024 - The Good, the Bad and the Governed by David O'Neill, ...Apidays New York 2024 - The Good, the Bad and the Governed by David O'Neill, ...
Apidays New York 2024 - The Good, the Bad and the Governed by David O'Neill, ...
 
Strategize a Smooth Tenant-to-tenant Migration and Copilot Takeoff
Strategize a Smooth Tenant-to-tenant Migration and Copilot TakeoffStrategize a Smooth Tenant-to-tenant Migration and Copilot Takeoff
Strategize a Smooth Tenant-to-tenant Migration and Copilot Takeoff
 
FWD Group - Insurer Innovation Award 2024
FWD Group - Insurer Innovation Award 2024FWD Group - Insurer Innovation Award 2024
FWD Group - Insurer Innovation Award 2024
 
MS Copilot expands with MS Graph connectors
MS Copilot expands with MS Graph connectorsMS Copilot expands with MS Graph connectors
MS Copilot expands with MS Graph connectors
 
Repurposing LNG terminals for Hydrogen Ammonia: Feasibility and Cost Saving
Repurposing LNG terminals for Hydrogen Ammonia: Feasibility and Cost SavingRepurposing LNG terminals for Hydrogen Ammonia: Feasibility and Cost Saving
Repurposing LNG terminals for Hydrogen Ammonia: Feasibility and Cost Saving
 
ProductAnonymous-April2024-WinProductDiscovery-MelissaKlemke
ProductAnonymous-April2024-WinProductDiscovery-MelissaKlemkeProductAnonymous-April2024-WinProductDiscovery-MelissaKlemke
ProductAnonymous-April2024-WinProductDiscovery-MelissaKlemke
 
Exploring Multimodal Embeddings with Milvus
Exploring Multimodal Embeddings with MilvusExploring Multimodal Embeddings with Milvus
Exploring Multimodal Embeddings with Milvus
 
How to Troubleshoot Apps for the Modern Connected Worker
How to Troubleshoot Apps for the Modern Connected WorkerHow to Troubleshoot Apps for the Modern Connected Worker
How to Troubleshoot Apps for the Modern Connected Worker
 
AWS Community Day CPH - Three problems of Terraform
AWS Community Day CPH - Three problems of TerraformAWS Community Day CPH - Three problems of Terraform
AWS Community Day CPH - Three problems of Terraform
 
Six Myths about Ontologies: The Basics of Formal Ontology
Six Myths about Ontologies: The Basics of Formal OntologySix Myths about Ontologies: The Basics of Formal Ontology
Six Myths about Ontologies: The Basics of Formal Ontology
 
Apidays New York 2024 - APIs in 2030: The Risk of Technological Sleepwalk by ...
Apidays New York 2024 - APIs in 2030: The Risk of Technological Sleepwalk by ...Apidays New York 2024 - APIs in 2030: The Risk of Technological Sleepwalk by ...
Apidays New York 2024 - APIs in 2030: The Risk of Technological Sleepwalk by ...
 
Web Form Automation for Bonterra Impact Management (fka Social Solutions Apri...
Web Form Automation for Bonterra Impact Management (fka Social Solutions Apri...Web Form Automation for Bonterra Impact Management (fka Social Solutions Apri...
Web Form Automation for Bonterra Impact Management (fka Social Solutions Apri...
 
[BuildWithAI] Introduction to Gemini.pdf
[BuildWithAI] Introduction to Gemini.pdf[BuildWithAI] Introduction to Gemini.pdf
[BuildWithAI] Introduction to Gemini.pdf
 
DEV meet-up UiPath Document Understanding May 7 2024 Amsterdam
DEV meet-up UiPath Document Understanding May 7 2024 AmsterdamDEV meet-up UiPath Document Understanding May 7 2024 Amsterdam
DEV meet-up UiPath Document Understanding May 7 2024 Amsterdam
 
Understanding the FAA Part 107 License ..
Understanding the FAA Part 107 License ..Understanding the FAA Part 107 License ..
Understanding the FAA Part 107 License ..
 
Platformless Horizons for Digital Adaptability
Platformless Horizons for Digital AdaptabilityPlatformless Horizons for Digital Adaptability
Platformless Horizons for Digital Adaptability
 
Artificial Intelligence Chap.5 : Uncertainty
Artificial Intelligence Chap.5 : UncertaintyArtificial Intelligence Chap.5 : Uncertainty
Artificial Intelligence Chap.5 : Uncertainty
 

Seminar Final.Key

  • 1. Function of NS2B for NS3 protease activation of Japanese encephalitis virus Mr.Chakard Chalayut Advisor: Assist.Prof Gerd Katzenmeier Laboratory of Molecular virology Institute of Molecular Biology & Genetics
  • 2. Japanese Encephalitis Virus (JEV) Culex tritaeniorhynchus. Source: fehd.gov.hk Source: news.bbc.co.uk
  • 3. Japanese Encephalitis Virus (JEV) Source : vietnammedicalpractice.com
  • 4. Japanese Encephalitis Virus (JEV) 50,000 Cases 10,000 30% fatality rate Source: medwork84.com Source: cdc.gov
  • 5. Prevention and treatment of JEV disease Drug No drug exist Vaccine development Available vaccine Elimination of mosquitoes Mosquitoes control breeding places
  • 6. Molecular biology of Japanese Encephalitis Virus Source : molecular-virology.uni-hd.de
  • 7. The NS2B • 130 aa Hypothetical model • activating domain NS2B-NS3 complex central hydrophilic region (Falgout et al, 1993) • 3 membrane spanning parts hydrophobicity plot ฺBrinkworth et al, 1999 51 DMWLERAADISWEMDAAITGSSRRLDVKLDDDGDFHLIDDPGVP 95
  • 8. The NS3 Protease NTPase •Chymotrypsin-like fold 2-β barrel Helicase RNA domains •Inactive alone Theoretical model from PDB •Enzyme’s pocket is small 2I84
  • 9. The NS3 protease Complexation with NS2B cofactor •NS3 serine protease domain 20 of thechange pocket kDa enzyme conformational alteration •catalytic residues binding site additional substrate His51, Asp75, Ser135
  • 10.
  • 11. • The result shown the slightly differences inby Some physico-chemical properties shared all the proteases. biochemical properties.
  • 12. Homology Modelling of NS3 protease
  • 13. Homology Modelling of NS3 protease WNV JEV DEN
  • 14.
  • 15.
  • 16. • The NS2B-NS3 can adopt two distinctfit mechanism. NS2B-NS3 WNV shown the induced conformation.
  • 17. • Two component of protease has a substrate specificity. • Two component of protease has a unique activation mechanism. • The NS3 protease share the similar structure in the Flavivirus group but are different in cofactor binding.
  • 18. • To investigate the function determination in the JEV NS2B for the activation of NS3 protease.
  • 19. Method 1.and mutation forms Expression and purification of deleted of NS2B-NS3 protease Full length NS2B and NS3 protease PCR to amply deleted and mutation forms of NS2B Clone into vector Expression and Purification SDS-PAGE and Western Blot
  • 21. Result Lane 1- 5 = Washing Fraction with 100 mM Imidazole Lane 6 -10 = Eluted Fraction with 400 mM Imidazole
  • 22. Method II Trans-cleavage of fluorogenie peptide substrate NS2B-NS3 protease Incubate with GKR-AMC Measured the florescence Change
  • 24. Method III Molecular Modelling of a JEV NS2B-NS3 complex JEV NS2B and NS3 protease protein Based on WNV crystallographic structure Perform the structural modelling by using Swiss modeling workstation & MEDock program
  • 26. Result Lane 1- 5 = Washing Fraction with 100 mM Imidazole Lane 6 -10 = Eluted Fraction with 400 mM Imidazole
  • 27. Discussion • Ser46 and Ile60 are essential region of JEV NS2B for activation of NS3 protease. • Alanine substitution demonstrate the functional conformation of Trp53, Glu55 and Arg56 in JEV NS2B for the cleavage ability of NS2B-NS3 protease. • Residues Ala67 to Asp76 of JEV NS2B suggested to provide the additional β- strands to stabilize the fold of NS3 protease.
  • 28. Discussion • Residues Lys78 to Leu87 of JEV NS2B may involved in the formation of the active site in the NS2B-NS3 protease.
  • 29. • Due to the substrate specificity of the NS2B-NS3 protease. • Can we make a very specific anti-viral drug to Flavivirus ? The pan-Flavivirus NS3 protease drugs may be developed for Flaviviral diseases.
  • 30. Thank you for your attention.