SlideShare une entreprise Scribd logo
1  sur  47
Discovery Platform
API Walkthrough
Paul Groth
@pgroth
http://www.few.vu.nl/~pgroth/
Public Drug Discovery Data:
Pharma are accessing, processing, storing & re-processing
Literature
PubChem
Genbank
Patents
Databases
Downloads
Data Integration Data Analysis
Firewalled Databases
www.openphacts.org
The Challenge
http://openphacts.org
pmu@openphacts.org
@Open_PHACTS
The Open PHACTS community ecosystem
Source Initial Records
Chembl 1,149,792
~1,091,462 cmpds
~8845 targets
DrugBank 19,628
~14,000 drugs
~5000 targets
UniProt 536,789
ENZYME 6,187
ChEBI 35,584
GO/GOA 38,137
ChemSpider/ACD 1,194,437
ConceptWiki 2,828,966
Data
Growing…..
Access to a wide range of interconnected data – easily jump between pharmacology, chemistry,
disease, pathways and other databases without having to perform complex mapping operations
Query by data type, not by data source (“Protein Information” not “Uniprot Information)
API queries that seamlessly connect data (for instance the Pharmacology query draws data from
Chembl, ChemSpider, ConceptWiki and Drugbank)
Strong chemistry representation – all chemicals reprocessed via Open PHACTS chemical registry to
ensure consistency across databases
Built using open community standards, not an ad-hoc solution. Developed in conjuction with 8 major
pharma (so your app will speak their language!)
Simple, flexible data-joining (join compound data ignoring salt forms, join protein data ignoring
species)
Provenance everywhere – every single data point tagged with source, version, author, etc
Nanopublication-enabled. Access to a rich dataset of established and emerging biomedical
“assertions”
Professionally Hosted (Continually Monitored)
Developer-friendly JSON/XML methods. Consistent API for multiple services
Seamless data upgrades. We manage updates so you don’t have to
Community-curation tools to enhance and correct content
Access to a rich application network (many different App builders)
Toolkits to support many different languages, workflow engines and user applications
Private and secure, suitable for confidential analyses
Active & still growing through a unique public-private partnership
Benefits
A Simple Restful API
Registering
The Hello World of Drug Discovery Apps
Entry Points
Compounds
Targets
Putting it together
Going Further
Simple http calls for
everything (you can put it in
a browser)
A RESTful API
Supports multiple formats
Both params and content negotiation
DEVELOPER & APP KEYS
Hello World!
Compound –
Target App
Sorafenib
SMILIES:
CNC(=O)c1cc(ccn1)Oc2ccc(cc2)NC(=O)Nc3ccc(c(c3)C(F)(F)F)Cl
ENTRY POINTS
Where do I start?
The API is URL centric
- http://rdf.chemspider.com/187440
- http://www.conceptwiki.org/concept/38932552-111f-4a4e-a46a-
4ed1d7bdf9d5
Where do I start?
The API is URL centric
- http://rdf.chemspider.com/187440
- http://www.conceptwiki.org/concept/38932552-111f-4a4e-
a46a-4ed1d7bdf9d5
Why?
- Ensures precise identification
- Allows for dereferencablity
- Note: supports many URLs from different domains
But what if I don’t have URL?
Entry Point APIs
Entry Point APIs
Sorafenib
Entry Point APIs
https://beta.openphacts.org/search/freetext?app_id=0e939a76&
app_key=1004d9ef5f4ee1ab0bbfc02b623cb955&q=sorafenib&_
format=json
Entry Point APIs
"_about": "http://www.conceptwiki.org/concept/38932552-111f-4a4e-a46a-4ed1d7bdf9d5",
Entry Point APIs
CNC(=O)c1cc(ccn1)Oc2ccc(cc2
)NC(=O)Nc3ccc(c(c3)C(F)(F)F)C
l
Entry Point APIs
Entry Point APIs
"_about": "http://rdf.chemspider.com/187440"
COMPOUND APIS
Compound APIs
Compound APIs:
Compound Information
We can use either:
http://www.conceptwiki.org/concept/38932552-111f-4a4e-a46a-4ed1d7bdf9d5
http://rdf.chemspider.com/187440
Compound APIs
Chembl
Chemspider
Compound APIs
Drugbank provenance - inDataset property
Compound APIs
Compound Pharmacology Paginated
Compound APIs
Compound Pharmacology Paginated
Compound APIs
Compound Pharmacology Paginated
"items": [
{
"_about": "http://data.kasabi.com/dataset/chembl-rdf/activity/a1650069",
"pmid": "15711537",
"forMolecule": {…},
"onAssay": {
…
"target": {
"_about": "http://data.kasabi.com/dataset/chembl-rdf/chemblid/CHEMBL4226",
"title": "Dual specificity protein kinase CLK3",
"organism": "Homo sapiens"
},
…
},
…
]
Compound APIs
Compound Pharmacology Paginated
TARGET APIS
Target APIs
Target APIs
Target Information
http://data.kasabi.com/dataset/chembl-
rdf/chemblid/CHEMBL4226
Target APIs
Target Information
PUTTING IT TOGETHER
Compound -> Target
in 3 URLs
1. Keyword to a compound URL
https://beta.openphacts.org/search/freetext?app_id=0e939a76&app_key=1004d9ef5f4ee1ab0bbfc0
2b623cb955&_format=json&q=sorafenib
1. Pharmacology for a compound
https://beta.openphacts.org/compound/pharmacology/pages?uri=http%3A%2F%2Fwww.concept
wiki.org%2Fconcept%2F38932552-111f-4a4e-a46a-
4ed1d7bdf9d5&app_id=0e939a76&app_key=1004d9ef5f4ee1ab0bbfc02b623cb955&_format=json
&_pageSize=10
1. More information about a target
https://beta.openphacts.org/target?uri=http%3A%2F%2Fdata.kasabi.com%2Fdataset%2Fchembl
-
rdf%2Fchemblid%2FCHEMBL4226&app_id=0e939a76&app_key=1004d9ef5f4ee1ab0bbfc02b623
cb955&_format=json
Sorafenib
`
SMILIES:
CNC(=O)c1cc(ccn1)Oc2ccc(cc2)NC(=O)Nc3ccc(c(c3)C(F)(F)F)Cl
Hello World!
Compound – Target App
Dual specificity protein kinase CLK3,
sequence":"MPVLSARRRELADHAGSGRRSGPSPTARSGPHLSALRAQPARAAHLSGRGTYVRRDTAGGGPGQARPLGPPGTSLL
GRGARRSGEGWCPGAFESGARAARPPSRVEPRLATAASREGAGLPRAEVAAGSGRGARSGEWGLAAAGAWETMHHCKRYRSP
EPDPYLSYRWKRRRSYSREHEGRLRYPSRREPPPRRSRSRSHDRLPYQRRYRERRDSDTYRCEERSPSFGEDYYGPSRSRHRR
RSRERGPYRTRKHAHHCHKRRTRSCSSASSRSQQSSKRSSRSVEDDKEGHLVCRIGDWLQERYEIVGNLGEGTFGKVVECLDHA
RGKSQVALKIIRNVGKYREAARLEINVLKKIKEKDKENKFLCVLMSDWFNFHGHMCIAFELLGKNTFEFLKENNFQPYPLPHVRHMAY
QLCHALRFLHENQLTHTDLKPENILFVNSEFETLYNEHKSCEEKSVKNTSIRVADFGSATFDHEHHTTIVATRHYRPPEVILELGWAQP
CDVWSIGCILFEYYRGFTLFQTHENREHLVMMEKILGPIPSHMIHRTRKQKYFYKGGLVWDENSSDGRYVKENCKPLKSYMLQDSLE
HVQLFDLMRRMLEFDPAQRITLAEALLHPFFAGLTPEERSFHTSRNPSR"
GOING FURTHER
More APIs
Classification APIs
Filtering
Client Libraries
Support for multiple languages
Still in development but useful to get started with
Easy to create libraries
Ruby
- https://github.com/openphacts/ops_gems
Javascript
- https://github.com/openphacts/ops.js
Java
- https://github.com/openphacts/JavaLDAClient
Workflows
https://dev.openphacts.org/workflow
https://github.com/openphacts
Coming Soon: 1.3 release
• Pathways
• CHEMBL Update
• New chemistry registration system
• Scientific Lenses
• More hierarchy/classification support
• Bonus :-)
Conclusion
http://dev.openphacts.org
Create!

Contenu connexe

Tendances

Tamino Mobile - XML based Integration, Development and Application Services f...
Tamino Mobile - XML based Integration, Development and Application Services f...Tamino Mobile - XML based Integration, Development and Application Services f...
Tamino Mobile - XML based Integration, Development and Application Services f...
mfrancis
 
API Driven Applications - An ecosystem architecture
API Driven Applications - An ecosystem architectureAPI Driven Applications - An ecosystem architecture
API Driven Applications - An ecosystem architecture
WSO2
 

Tendances (20)

PuppetConf 2017 | Adobe Advertising Cloud: A Lean Puppet Workflow to Support ...
PuppetConf 2017 | Adobe Advertising Cloud: A Lean Puppet Workflow to Support ...PuppetConf 2017 | Adobe Advertising Cloud: A Lean Puppet Workflow to Support ...
PuppetConf 2017 | Adobe Advertising Cloud: A Lean Puppet Workflow to Support ...
 
apidays LIVE Paris 2021 - Getting started with Event-Driven APis by Hugo Guer...
apidays LIVE Paris 2021 - Getting started with Event-Driven APis by Hugo Guer...apidays LIVE Paris 2021 - Getting started with Event-Driven APis by Hugo Guer...
apidays LIVE Paris 2021 - Getting started with Event-Driven APis by Hugo Guer...
 
2019 04 seattle_meetup___kafka_machine_learning___kai_waehner
2019 04 seattle_meetup___kafka_machine_learning___kai_waehner2019 04 seattle_meetup___kafka_machine_learning___kai_waehner
2019 04 seattle_meetup___kafka_machine_learning___kai_waehner
 
The Elephant in the Kubernetes Room - Team Interactions at Scale @ KubeCon No...
The Elephant in the Kubernetes Room - Team Interactions at Scale @ KubeCon No...The Elephant in the Kubernetes Room - Team Interactions at Scale @ KubeCon No...
The Elephant in the Kubernetes Room - Team Interactions at Scale @ KubeCon No...
 
Apinf Open Api Management
Apinf Open Api Management Apinf Open Api Management
Apinf Open Api Management
 
Tamino Mobile - XML based Integration, Development and Application Services f...
Tamino Mobile - XML based Integration, Development and Application Services f...Tamino Mobile - XML based Integration, Development and Application Services f...
Tamino Mobile - XML based Integration, Development and Application Services f...
 
INTERFACE, by apidays - Playing with FHIR: Hacking FHIR and mHealth APIs by ...
INTERFACE, by apidays  - Playing with FHIR: Hacking FHIR and mHealth APIs by ...INTERFACE, by apidays  - Playing with FHIR: Hacking FHIR and mHealth APIs by ...
INTERFACE, by apidays - Playing with FHIR: Hacking FHIR and mHealth APIs by ...
 
Building scalable applications for the cloud
Building scalable applications for the cloudBuilding scalable applications for the cloud
Building scalable applications for the cloud
 
Austin API Summit 2018: Are REST APIs Still Relevant Today?
Austin API Summit 2018: Are REST APIs Still Relevant Today?Austin API Summit 2018: Are REST APIs Still Relevant Today?
Austin API Summit 2018: Are REST APIs Still Relevant Today?
 
apidays LIVE Hong Kong 2021 - Multi-Protocol APIs at Scale in Adidas by Jesus...
apidays LIVE Hong Kong 2021 - Multi-Protocol APIs at Scale in Adidas by Jesus...apidays LIVE Hong Kong 2021 - Multi-Protocol APIs at Scale in Adidas by Jesus...
apidays LIVE Hong Kong 2021 - Multi-Protocol APIs at Scale in Adidas by Jesus...
 
API Driven Applications - An ecosystem architecture
API Driven Applications - An ecosystem architectureAPI Driven Applications - An ecosystem architecture
API Driven Applications - An ecosystem architecture
 
GlueCon 2019: Beyond REST - Moving to Event-Based APIs and Streaming
GlueCon 2019: Beyond REST - Moving to Event-Based APIs and StreamingGlueCon 2019: Beyond REST - Moving to Event-Based APIs and Streaming
GlueCon 2019: Beyond REST - Moving to Event-Based APIs and Streaming
 
Gravitee API Management - Ahmet AYDIN
 Gravitee API Management  -  Ahmet AYDIN Gravitee API Management  -  Ahmet AYDIN
Gravitee API Management - Ahmet AYDIN
 
Austin API Summit 2019 - APIs, Microservices, and Serverless: The Shape of Th...
Austin API Summit 2019 - APIs, Microservices, and Serverless: The Shape of Th...Austin API Summit 2019 - APIs, Microservices, and Serverless: The Shape of Th...
Austin API Summit 2019 - APIs, Microservices, and Serverless: The Shape of Th...
 
Enterprise solution Workrocks
Enterprise solution WorkrocksEnterprise solution Workrocks
Enterprise solution Workrocks
 
API Security Webinar : Security Guidelines for Providing and Consuming APIs
API Security Webinar : Security Guidelines for Providing and Consuming APIsAPI Security Webinar : Security Guidelines for Providing and Consuming APIs
API Security Webinar : Security Guidelines for Providing and Consuming APIs
 
apidays LIVE Paris 2021 - Deliver real-time data to customer using Streaming ...
apidays LIVE Paris 2021 - Deliver real-time data to customer using Streaming ...apidays LIVE Paris 2021 - Deliver real-time data to customer using Streaming ...
apidays LIVE Paris 2021 - Deliver real-time data to customer using Streaming ...
 
Crossing the low-code and pro-code chasm: a platform approach
Crossing the low-code and pro-code chasm: a platform approachCrossing the low-code and pro-code chasm: a platform approach
Crossing the low-code and pro-code chasm: a platform approach
 
Proliferating OpenAPI at Google
Proliferating OpenAPI at GoogleProliferating OpenAPI at Google
Proliferating OpenAPI at Google
 
[apidays Live Australia] - Quantum Duality of “API as a business and a techno...
[apidays Live Australia] - Quantum Duality of “API as a business and a techno...[apidays Live Australia] - Quantum Duality of “API as a business and a techno...
[apidays Live Australia] - Quantum Duality of “API as a business and a techno...
 

En vedette

En vedette (20)

Telling your research story with (alt)metrics
Telling your research story with (alt)metricsTelling your research story with (alt)metrics
Telling your research story with (alt)metrics
 
"Don't Publish, Release" - Revisited
"Don't Publish, Release" - Revisited "Don't Publish, Release" - Revisited
"Don't Publish, Release" - Revisited
 
Data Integration vs Transparency: Tackling the tension
Data Integration vs Transparency: Tackling the tensionData Integration vs Transparency: Tackling the tension
Data Integration vs Transparency: Tackling the tension
 
Transparency in the Data Supply Chain
Transparency in the Data Supply ChainTransparency in the Data Supply Chain
Transparency in the Data Supply Chain
 
Altmetrics: painting a broader picture of impact
Altmetrics: painting a broader picture of impactAltmetrics: painting a broader picture of impact
Altmetrics: painting a broader picture of impact
 
Information architecture at Elsevier
Information architecture at ElsevierInformation architecture at Elsevier
Information architecture at Elsevier
 
Decoupling Provenance Capture and Analysis from Execution
Decoupling Provenance Capture and Analysis from ExecutionDecoupling Provenance Capture and Analysis from Execution
Decoupling Provenance Capture and Analysis from Execution
 
Data for Science: How Elsevier is using data science to empower researchers
Data for Science: How Elsevier is using data science to empower researchersData for Science: How Elsevier is using data science to empower researchers
Data for Science: How Elsevier is using data science to empower researchers
 
Research Data Sharing: A Basic Framework
Research Data Sharing: A Basic FrameworkResearch Data Sharing: A Basic Framework
Research Data Sharing: A Basic Framework
 
Sources of Change in Modern Knowledge Organization Systems
Sources of Change in Modern Knowledge Organization SystemsSources of Change in Modern Knowledge Organization Systems
Sources of Change in Modern Knowledge Organization Systems
 
Structured Data & the Future of Educational Material
Structured Data & the Future of Educational MaterialStructured Data & the Future of Educational Material
Structured Data & the Future of Educational Material
 
Knowledge Graphs at Elsevier
Knowledge Graphs at ElsevierKnowledge Graphs at Elsevier
Knowledge Graphs at Elsevier
 
Tradeoffs in Automatic Provenance Capture
Tradeoffs in Automatic Provenance CaptureTradeoffs in Automatic Provenance Capture
Tradeoffs in Automatic Provenance Capture
 
Provenance for Data Munging Environments
Provenance for Data Munging EnvironmentsProvenance for Data Munging Environments
Provenance for Data Munging Environments
 
The Kasabi Information Marketplace
The Kasabi Information MarketplaceThe Kasabi Information Marketplace
The Kasabi Information Marketplace
 
2014-03-20 Open PHACTS - A Data Platform for Drug Discovery
2014-03-20 Open PHACTS - A Data Platform for Drug Discovery2014-03-20 Open PHACTS - A Data Platform for Drug Discovery
2014-03-20 Open PHACTS - A Data Platform for Drug Discovery
 
Authoring Linked Data using Semantic MediaWiki
Authoring Linked Data using Semantic MediaWikiAuthoring Linked Data using Semantic MediaWiki
Authoring Linked Data using Semantic MediaWiki
 
Open PHACTS (Sept 2013) EBI Industry Programme
Open PHACTS (Sept 2013) EBI Industry ProgrammeOpen PHACTS (Sept 2013) EBI Industry Programme
Open PHACTS (Sept 2013) EBI Industry Programme
 
The Pistoia Alliance Biology Domain Strategy April 2011
The Pistoia Alliance Biology Domain Strategy April 2011The Pistoia Alliance Biology Domain Strategy April 2011
The Pistoia Alliance Biology Domain Strategy April 2011
 
Knowledge Graph Construction and the Role of DBPedia
Knowledge Graph Construction and the Role of DBPediaKnowledge Graph Construction and the Role of DBPedia
Knowledge Graph Construction and the Role of DBPedia
 

Similaire à Open PHACTS API Walkthrough

Practical semantics in the pharmaceutical industry - the Open PHACTS project
Practical semantics in the pharmaceutical industry - the Open PHACTS projectPractical semantics in the pharmaceutical industry - the Open PHACTS project
Practical semantics in the pharmaceutical industry - the Open PHACTS project
US Environmental Protection Agency (EPA), Center for Computational Toxicology and Exposure
 
Smart-Indivo App Challenge Webinar
Smart-Indivo App Challenge WebinarSmart-Indivo App Challenge Webinar
Smart-Indivo App Challenge Webinar
health2dev
 

Similaire à Open PHACTS API Walkthrough (20)

Open PHACTS MIOSS may 2016
Open PHACTS MIOSS may 2016Open PHACTS MIOSS may 2016
Open PHACTS MIOSS may 2016
 
SC1 - Hangout 2: The Open PHACTS pilot
SC1 - Hangout 2: The Open PHACTS pilotSC1 - Hangout 2: The Open PHACTS pilot
SC1 - Hangout 2: The Open PHACTS pilot
 
2015-02-10 The Open PHACTS Discovery Platform: Semantic Data Integration for ...
2015-02-10 The Open PHACTS Discovery Platform: Semantic Data Integration for ...2015-02-10 The Open PHACTS Discovery Platform: Semantic Data Integration for ...
2015-02-10 The Open PHACTS Discovery Platform: Semantic Data Integration for ...
 
Tag.bio aws public jun 08 2021
Tag.bio aws public jun 08 2021 Tag.bio aws public jun 08 2021
Tag.bio aws public jun 08 2021
 
Practical semantics in the pharmaceutical industry - the Open PHACTS project
Practical semantics in the pharmaceutical industry - the Open PHACTS projectPractical semantics in the pharmaceutical industry - the Open PHACTS project
Practical semantics in the pharmaceutical industry - the Open PHACTS project
 
Implementing chemistry platform for OpenPHACTS
Implementing chemistry platform for OpenPHACTSImplementing chemistry platform for OpenPHACTS
Implementing chemistry platform for OpenPHACTS
 
Aneesh Chopra's Keynote at the Health 2.0's Provider Symposium
Aneesh Chopra's Keynote at the Health 2.0's Provider SymposiumAneesh Chopra's Keynote at the Health 2.0's Provider Symposium
Aneesh Chopra's Keynote at the Health 2.0's Provider Symposium
 
2011-12-02 Open PHACTS at STM Innovation
2011-12-02 Open PHACTS at STM Innovation2011-12-02 Open PHACTS at STM Innovation
2011-12-02 Open PHACTS at STM Innovation
 
OpenAIRE services and tools for Open Science
OpenAIRE services and tools for Open Science OpenAIRE services and tools for Open Science
OpenAIRE services and tools for Open Science
 
BDE SC1 Workshop 3 - Open PHACTS Pilot (Kiera McNeice)
BDE SC1 Workshop 3 - Open PHACTS Pilot (Kiera McNeice)BDE SC1 Workshop 3 - Open PHACTS Pilot (Kiera McNeice)
BDE SC1 Workshop 3 - Open PHACTS Pilot (Kiera McNeice)
 
Semantic Web Adoption
Semantic Web AdoptionSemantic Web Adoption
Semantic Web Adoption
 
Mobile chemistry apps
Mobile chemistry appsMobile chemistry apps
Mobile chemistry apps
 
The use of R statistical package in controlled infrastructure. The case of Cl...
The use of R statistical package in controlled infrastructure. The case of Cl...The use of R statistical package in controlled infrastructure. The case of Cl...
The use of R statistical package in controlled infrastructure. The case of Cl...
 
openEHR / HANDI-HOPD Workshop at Open Innovation
openEHR / HANDI-HOPD Workshop at Open InnovationopenEHR / HANDI-HOPD Workshop at Open Innovation
openEHR / HANDI-HOPD Workshop at Open Innovation
 
OpenAIRE services & tools: Zenodo and what's next (Danish OpenAIRE workshop)
OpenAIRE services & tools: Zenodo and what's next (Danish OpenAIRE workshop)OpenAIRE services & tools: Zenodo and what's next (Danish OpenAIRE workshop)
OpenAIRE services & tools: Zenodo and what's next (Danish OpenAIRE workshop)
 
OpenAIRE Infrastructure & Services: we need your input!
OpenAIRE Infrastructure & Services: we need your input!OpenAIRE Infrastructure & Services: we need your input!
OpenAIRE Infrastructure & Services: we need your input!
 
The openEHR Revolution Heidelberg 2018
The openEHR Revolution Heidelberg 2018The openEHR Revolution Heidelberg 2018
The openEHR Revolution Heidelberg 2018
 
Hu7 kuraitis
Hu7 kuraitisHu7 kuraitis
Hu7 kuraitis
 
A Manifesto for Healthcare’s Disruptive Innovation of the Decade: Open EHR Te...
A Manifesto for Healthcare’s Disruptive Innovation of the Decade: Open EHR Te...A Manifesto for Healthcare’s Disruptive Innovation of the Decade: Open EHR Te...
A Manifesto for Healthcare’s Disruptive Innovation of the Decade: Open EHR Te...
 
Smart-Indivo App Challenge Webinar
Smart-Indivo App Challenge WebinarSmart-Indivo App Challenge Webinar
Smart-Indivo App Challenge Webinar
 

Plus de Paul Groth

Plus de Paul Groth (20)

Data Curation and Debugging for Data Centric AI
Data Curation and Debugging for Data Centric AIData Curation and Debugging for Data Centric AI
Data Curation and Debugging for Data Centric AI
 
Content + Signals: The value of the entire data estate for machine learning
Content + Signals: The value of the entire data estate for machine learningContent + Signals: The value of the entire data estate for machine learning
Content + Signals: The value of the entire data estate for machine learning
 
Data Communities - reusable data in and outside your organization.
Data Communities - reusable data in and outside your organization.Data Communities - reusable data in and outside your organization.
Data Communities - reusable data in and outside your organization.
 
Minimal viable-datareuse-czi
Minimal viable-datareuse-cziMinimal viable-datareuse-czi
Minimal viable-datareuse-czi
 
Knowledge Graph Maintenance
Knowledge Graph MaintenanceKnowledge Graph Maintenance
Knowledge Graph Maintenance
 
Knowledge Graph Futures
Knowledge Graph FuturesKnowledge Graph Futures
Knowledge Graph Futures
 
Knowledge Graph Maintenance
Knowledge Graph MaintenanceKnowledge Graph Maintenance
Knowledge Graph Maintenance
 
Thoughts on Knowledge Graphs & Deeper Provenance
Thoughts on Knowledge Graphs  & Deeper ProvenanceThoughts on Knowledge Graphs  & Deeper Provenance
Thoughts on Knowledge Graphs & Deeper Provenance
 
Thinking About the Making of Data
Thinking About the Making of DataThinking About the Making of Data
Thinking About the Making of Data
 
End-to-End Learning for Answering Structured Queries Directly over Text
End-to-End Learning for  Answering Structured Queries Directly over Text End-to-End Learning for  Answering Structured Queries Directly over Text
End-to-End Learning for Answering Structured Queries Directly over Text
 
From Data Search to Data Showcasing
From Data Search to Data ShowcasingFrom Data Search to Data Showcasing
From Data Search to Data Showcasing
 
Elsevier’s Healthcare Knowledge Graph
Elsevier’s Healthcare Knowledge GraphElsevier’s Healthcare Knowledge Graph
Elsevier’s Healthcare Knowledge Graph
 
The Challenge of Deeper Knowledge Graphs for Science
The Challenge of Deeper Knowledge Graphs for ScienceThe Challenge of Deeper Knowledge Graphs for Science
The Challenge of Deeper Knowledge Graphs for Science
 
More ways of symbol grounding for knowledge graphs?
More ways of symbol grounding for knowledge graphs?More ways of symbol grounding for knowledge graphs?
More ways of symbol grounding for knowledge graphs?
 
Diversity and Depth: Implementing AI across many long tail domains
Diversity and Depth: Implementing AI across many long tail domainsDiversity and Depth: Implementing AI across many long tail domains
Diversity and Depth: Implementing AI across many long tail domains
 
Progressive Provenance Capture Through Re-computation
Progressive Provenance Capture Through Re-computationProgressive Provenance Capture Through Re-computation
Progressive Provenance Capture Through Re-computation
 
From Text to Data to the World: The Future of Knowledge Graphs
From Text to Data to the World: The Future of Knowledge GraphsFrom Text to Data to the World: The Future of Knowledge Graphs
From Text to Data to the World: The Future of Knowledge Graphs
 
Combining Explicit and Latent Web Semantics for Maintaining Knowledge Graphs
Combining Explicit and Latent Web Semantics for Maintaining Knowledge GraphsCombining Explicit and Latent Web Semantics for Maintaining Knowledge Graphs
Combining Explicit and Latent Web Semantics for Maintaining Knowledge Graphs
 
The need for a transparent data supply chain
The need for a transparent data supply chainThe need for a transparent data supply chain
The need for a transparent data supply chain
 
Knowledge graph construction for research & medicine
Knowledge graph construction for research & medicineKnowledge graph construction for research & medicine
Knowledge graph construction for research & medicine
 

Dernier

Why Teams call analytics are critical to your entire business
Why Teams call analytics are critical to your entire businessWhy Teams call analytics are critical to your entire business
Why Teams call analytics are critical to your entire business
panagenda
 
Cloud Frontiers: A Deep Dive into Serverless Spatial Data and FME
Cloud Frontiers:  A Deep Dive into Serverless Spatial Data and FMECloud Frontiers:  A Deep Dive into Serverless Spatial Data and FME
Cloud Frontiers: A Deep Dive into Serverless Spatial Data and FME
Safe Software
 

Dernier (20)

How to Troubleshoot Apps for the Modern Connected Worker
How to Troubleshoot Apps for the Modern Connected WorkerHow to Troubleshoot Apps for the Modern Connected Worker
How to Troubleshoot Apps for the Modern Connected Worker
 
Powerful Google developer tools for immediate impact! (2023-24 C)
Powerful Google developer tools for immediate impact! (2023-24 C)Powerful Google developer tools for immediate impact! (2023-24 C)
Powerful Google developer tools for immediate impact! (2023-24 C)
 
Apidays New York 2024 - Accelerating FinTech Innovation by Vasa Krishnan, Fin...
Apidays New York 2024 - Accelerating FinTech Innovation by Vasa Krishnan, Fin...Apidays New York 2024 - Accelerating FinTech Innovation by Vasa Krishnan, Fin...
Apidays New York 2024 - Accelerating FinTech Innovation by Vasa Krishnan, Fin...
 
Why Teams call analytics are critical to your entire business
Why Teams call analytics are critical to your entire businessWhy Teams call analytics are critical to your entire business
Why Teams call analytics are critical to your entire business
 
Strategies for Unlocking Knowledge Management in Microsoft 365 in the Copilot...
Strategies for Unlocking Knowledge Management in Microsoft 365 in the Copilot...Strategies for Unlocking Knowledge Management in Microsoft 365 in the Copilot...
Strategies for Unlocking Knowledge Management in Microsoft 365 in the Copilot...
 
ICT role in 21st century education and its challenges
ICT role in 21st century education and its challengesICT role in 21st century education and its challenges
ICT role in 21st century education and its challenges
 
Automating Google Workspace (GWS) & more with Apps Script
Automating Google Workspace (GWS) & more with Apps ScriptAutomating Google Workspace (GWS) & more with Apps Script
Automating Google Workspace (GWS) & more with Apps Script
 
Axa Assurance Maroc - Insurer Innovation Award 2024
Axa Assurance Maroc - Insurer Innovation Award 2024Axa Assurance Maroc - Insurer Innovation Award 2024
Axa Assurance Maroc - Insurer Innovation Award 2024
 
Mastering MySQL Database Architecture: Deep Dive into MySQL Shell and MySQL R...
Mastering MySQL Database Architecture: Deep Dive into MySQL Shell and MySQL R...Mastering MySQL Database Architecture: Deep Dive into MySQL Shell and MySQL R...
Mastering MySQL Database Architecture: Deep Dive into MySQL Shell and MySQL R...
 
TrustArc Webinar - Unlock the Power of AI-Driven Data Discovery
TrustArc Webinar - Unlock the Power of AI-Driven Data DiscoveryTrustArc Webinar - Unlock the Power of AI-Driven Data Discovery
TrustArc Webinar - Unlock the Power of AI-Driven Data Discovery
 
Polkadot JAM Slides - Token2049 - By Dr. Gavin Wood
Polkadot JAM Slides - Token2049 - By Dr. Gavin WoodPolkadot JAM Slides - Token2049 - By Dr. Gavin Wood
Polkadot JAM Slides - Token2049 - By Dr. Gavin Wood
 
Cloud Frontiers: A Deep Dive into Serverless Spatial Data and FME
Cloud Frontiers:  A Deep Dive into Serverless Spatial Data and FMECloud Frontiers:  A Deep Dive into Serverless Spatial Data and FME
Cloud Frontiers: A Deep Dive into Serverless Spatial Data and FME
 
FWD Group - Insurer Innovation Award 2024
FWD Group - Insurer Innovation Award 2024FWD Group - Insurer Innovation Award 2024
FWD Group - Insurer Innovation Award 2024
 
DBX First Quarter 2024 Investor Presentation
DBX First Quarter 2024 Investor PresentationDBX First Quarter 2024 Investor Presentation
DBX First Quarter 2024 Investor Presentation
 
Strategies for Landing an Oracle DBA Job as a Fresher
Strategies for Landing an Oracle DBA Job as a FresherStrategies for Landing an Oracle DBA Job as a Fresher
Strategies for Landing an Oracle DBA Job as a Fresher
 
EMPOWERMENT TECHNOLOGY GRADE 11 QUARTER 2 REVIEWER
EMPOWERMENT TECHNOLOGY GRADE 11 QUARTER 2 REVIEWEREMPOWERMENT TECHNOLOGY GRADE 11 QUARTER 2 REVIEWER
EMPOWERMENT TECHNOLOGY GRADE 11 QUARTER 2 REVIEWER
 
Connector Corner: Accelerate revenue generation using UiPath API-centric busi...
Connector Corner: Accelerate revenue generation using UiPath API-centric busi...Connector Corner: Accelerate revenue generation using UiPath API-centric busi...
Connector Corner: Accelerate revenue generation using UiPath API-centric busi...
 
Corporate and higher education May webinar.pptx
Corporate and higher education May webinar.pptxCorporate and higher education May webinar.pptx
Corporate and higher education May webinar.pptx
 
AXA XL - Insurer Innovation Award Americas 2024
AXA XL - Insurer Innovation Award Americas 2024AXA XL - Insurer Innovation Award Americas 2024
AXA XL - Insurer Innovation Award Americas 2024
 
A Beginners Guide to Building a RAG App Using Open Source Milvus
A Beginners Guide to Building a RAG App Using Open Source MilvusA Beginners Guide to Building a RAG App Using Open Source Milvus
A Beginners Guide to Building a RAG App Using Open Source Milvus
 

Open PHACTS API Walkthrough

Notes de l'éditeur

  1. Just a note, when using the documentation page watch out for spaces in your queries.
  2. Just stick it in a browser 
  3. _about is a central concept
  4. Two important ones compount info and compound pharma paginated
  5. https://beta.openphacts.org/compound?uri=http%3A%2F%2Fwww.conceptwiki.org%2Fconcept%2F38932552-111f-4a4e-a46a-4ed1d7bdf9d5+&app_id=0e939a76&app_key=1004d9ef5f4ee1ab0bbfc02b623cb955
  6. The Response is organized by data source with different properties selected from those different data sources
  7. The Response is organized by data source with different properties selected from those different data sources
  8. A lot of filtering options (point out that only bullets are required)https://beta.openphacts.org/compound/pharmacology/pages?uri=http%3A%2F%2Frdf.chemspider.com%2F187440&app_id=0e939a76&app_key=1004d9ef5f4ee1ab0bbfc02b623cb955&_pageSize=10
  9. Pagination
  10. Results
  11. Pagination
  12. Pagination
  13. https://beta.openphacts.org/target?uri=http%3A%2F%2Fdata.kasabi.com%2Fdataset%2Fchembl-rdf%2Fchemblid%2FCHEMBL4226&app_id=0e939a76&app_key=1004d9ef5f4ee1ab0bbfc02b623cb955
  14. https://beta.openphacts.org/target?uri=http%3A%2F%2Fdata.kasabi.com%2Fdataset%2Fchembl-rdf%2Fchemblid%2FCHEMBL4226&app_id=0e939a76&app_key=1004d9ef5f4ee1ab0bbfc02b623cb955