SlideShare une entreprise Scribd logo
1  sur  22
Télécharger pour lire hors ligne
©2015 Waters Corporation 1
Identification of Meat Species in
Processed Foods using
Mass Spectrometry
©2015 Waters Corporation 2
Presentation Overview
 Background
– Food labelling regulations
– Water retaining agents in chicken products
– Use of gelatine
 Research Objectives
 Proposed solution
– Sample preparation procedure
– LC-MS approach
– Data interpretation
 Results
– Identification of potential peptide markers
– Quantification of markers
 Future work using Xevo TQ-S
 Conclusions
©2015 Waters Corporation 3
Meat speciation – regulatory
requirements
 Authenticity of food and the accuracy of package labeling is important
to both consumers and food producers
 Within the EC food labeling regulations exist
– ~5 M people in UK have preferences concerning consumption of certain
species
 Composition of injection powders?
– Undeclared water-retaining hydrolysed proteins from pork and beef
used in chicken products
– Some chicken products potentially unsuitable for consumers
 Need to verify the species of gelatine used in food
©2015 Waters Corporation 4
Injection powders - gelatine
 What is it?
– Bi-product from the meat / fish industry
– partial hydrolysis of collagen extracted from skin,
bones, connective tissue
 Properties of gelatine
– Gelling agent
– Semi-solid colloid gel
– Texture enhancer
 Approx annual production:
– Europe: 117kt (70% used in food)
 What is it used for?
– Food and Beverages
– Drugs and capsules
– Cosmetics
– Photographic film
– Fertilisers…
©2015 Waters Corporation 5
Research objectives and aims
 Develop a method to detect species and tissue origin of meat
ingredients present in meat products
1. To identify unequivocal markers that can indicate the presence of
bovine or porcine gelatine
2. To determine whether chicken products have been adulterated
with proteins from other animal species
3. To develop a robust and transferable method
 Current limitations…
– Paper trail is not sufficient
– FSA concluded that PCR / IA based strategies are not reliable
• DNA markers damaged by processing conditions
• False negative rate
 Possible Solutions?
– LC-MS/MS using a proteomic workflow
©2015 Waters Corporation 6
Alternative strategy =
proteomic based analytical strategy to
identify peptide markers using HR-MS
©2015 Waters Corporation 7
Bottom-up proteomic experiment
1. Enzyme
digestion
2. UPLC
separation
Precursor
ions
MSE product
ions
3. MS
analysis
4. Data
interpretation
©2015 Waters Corporation 8
Meat Speciation Workflow
SAMPLE PREPARATION
(1) Tryptic digest (2) ADH addition
DATA ACQUISITION
Acquire data-independent MSE Data
SOFTWARE PROCESSING
IdentityE and gelatine database (BioArch)
ANALYTICAL SYSTEMS
(1) nanoACQUITY UPLC ® (2) XevoTM QTof MS
Nano-scale
separations
•Resolution
•Peak shape
•Number of
components
/ analytical
run
Full scan,
accurate
mass
©2015 Waters Corporation 9
Meat Speciation Workflow
Sample Preparation
 Samples
– Protein tryptic digests;
o pork gelatine
o beef gelatine
o pork & beef gelatine mix
 Tryptic digest
– 250 μg of porcine and bovine gelatine were hydrolysed with 5 μg of
sequence grade trypsin for 16hr
 ADH addition
– Quench reaction with formic acid
– 10 fmol of yeast alcohol dehydrogenase (internal standard) added
tryptic digest
SAMPLE PREPARATION
(1) Tryptic digest (2) ADH addition
©2015 Waters Corporation 10
UPLC Conditions
 System
– NanoACQUITY® UPLC
 Column:
– 75 µm x 15 cm BEH C18 column
 Gradient:
– 1 to 40% acetonitrile
– 90 min
 Flow rate:
– 300 nL/min
 Triplicate analysis
MS Conditions
 System
– Xevo QTof MS
 Mass range:
– m/z 50-1990
 Data Acquisition:
– MSE
 Collision energy:
– Low energy - 4 eV
– High energy - 12-35 eV
 Acquisition scan time:
– 0.9 s/function
Meat Speciation Workflow
UPLC-MS conditions
OPTIMISED ANALYTICAL PARAMETERS
(1) nanoACQUITY UPLC ® (2) XevoTM QTof MS
©2015 Waters Corporation 11
Meat Speciation Workflow
MSE
 UPLC-MSE is a data independent parallel process that occurs in
the collision cell
 The instrument is operated in an alternative scanning mode
providing two MS scan functions for data acquisition in one
analytical run
– Function 1 = low collision energy (precursor ions) Function 2 =
high energy (fragment ions)
DATA ACQUISITION
Acquire data-independent MSE Data
©2015 Waters Corporation 12
Meat Speciation Workflow
Software processing
SOFTWARE PROCESSING
PLGS and IdentityE
Positive matches referenced to
database library
Increasing confidence in assignment of peptides
©2015 Waters Corporation 13
Results and Discussion
©2015 Waters Corporation 14
nanoACQUITY replicate injections (n=3)
Beef gelatine
Repeatable results
Overlay low energy MSE chromatograms
©2015 Waters Corporation 15
Meat Speciation Workflow
Software processing
High energy product ion data gives increased confidence in peptide sequence identification
Low energy data can be displayed as a mass
spectrum or a chromatogram
Markers originated from a SINGLE protein
Unique marker peptides sequences listed here
©2015 Waters Corporation 16
Discovery & Identification
Total Marker Peptides
Aim to obtain a peptide marker that is unmodified (if possible)
 Over 60 collagen peptides were identified in samples of both bovine and
porcine gelatines
 IdentityE did not identify peptides from any other proteins
– Collagen
– Yeast ADH
 Indicates the samples were 100% gelatine
Multiple
forms of the
peptides
identified
Species peptide Peptide mass Type of peptide modification
Bovine
GYPGNPGPAGAAGAP 1235.58 Non-tryptic cleavage product
GYPGNPGPAGAAGAPGPQGAVGPAGK 2173.08 Unmodified peptide
GYPGNPGPAGAAGAPGPQGAVGPAGK 2189.07 Hydroxyl of single proline
GYPGNPGPAGAAGAPGPQGAVGPAGK 2205.07 Hydroxylation of prolines 3 and 15
GYPGNPGPAGAAGAPGPQGAVGPAGK 2221.06 Three hydroxyprolines
GYPGNPGPAGAAGAPGPQGAVGPAGKHGNR 2653.3 Missed tryptic cleavage hydroxylation of proline
29
GYPGNPGPAGAAGAPGPQGAVGPAGKHGNR 2669.29 Missed cleavage plus two proline hydroxylations
Porcine
IGQPGAVGPAGIR 1192.68 Deamidation + Q3
IGQPGAVGPAGIR 1193.66 Hydroxyl + DKNP 4
IGQPGAVGPAGIR 1208.67
IGQPGAVGPAGIR 1209.66 Deamidation +Q3; Hydroxyl+DKNP9
©2015 Waters Corporation 17
Discovery & Identification
Unique Unmodified Marker Peptides
Bovine peptide marker
IGQPGAVAPAGIR
Porcine peptide marker
TGQPGAVAPAGIR
Comparison of high energy MSE fragment ion spectra
Differences
in b and y
ions formed
©2015 Waters Corporation 18
Quantification
Porcine and bovine gelatine
 Use of ADH enabled quantification of proteins in sample
Removes need to use labelling systems for peptide and
protein quantification
Test mix was prepared
Addition of 15%(w/w) bovine gelatine in porcine gelatine
Results
Three bovine and porcine peptides were selected - relative
bovine gelatine content of ~ 16.8%
©2015 Waters Corporation 19
Conclusions
 Highly processed food proteins, such as gelatine, that
are devoid of DNA signature can be speciated using
LC-MS
 Protein sequence database analysis identified peptide
sequences within the protein that are species specific
 Waters Xevo Qtof MS was able to identify these
sequences, even after significant modification of the
amino acids
 The interrogation of the total protein complement of
the sample also provided potential information on
non-gelatine proteins in the samples
©2015 Waters Corporation 20
Further Work
Preliminary data suggests the method can
be used to quantify the species in mixtures
of gelatines
 Investigate the contribution that type III
collagen (from skin and connective tissue)
might make to the quantitative analysis
of gelatines
©2015 Waters Corporation 21
Future Work
Method transfer to routine analysis using tandem quad
MS/MS
©2015 Waters Corporation 22
Acknowledgments
Helen Grundy - Food and Environment
Research Agency, York, UK
BioArCh, University of York, UK
Thank you for your attention
Any Questions?

Contenu connexe

Tendances

MALDI-TOF: Pricinple and Its Application in Biochemistry and Biotechnology
MALDI-TOF: Pricinple  and Its Application in Biochemistry and BiotechnologyMALDI-TOF: Pricinple  and Its Application in Biochemistry and Biotechnology
MALDI-TOF: Pricinple and Its Application in Biochemistry and BiotechnologyDevakumar Jain
 
Interesterification
Interesterification Interesterification
Interesterification Anees Arain
 
Quality assurance in milk and milk products copy
Quality assurance in milk and milk products   copyQuality assurance in milk and milk products   copy
Quality assurance in milk and milk products copyChoclaty Ashish
 
Kefir production
Kefir productionKefir production
Kefir productionMoksha Chib
 
Scoring schemes in bioinformatics
Scoring schemes in bioinformaticsScoring schemes in bioinformatics
Scoring schemes in bioinformaticsSumatiHajela
 
Characterization of protein
Characterization of proteinCharacterization of protein
Characterization of proteinKAUSHAL SAHU
 
Rapid methods for detection of Food-borne Pathogens.
Rapid methods for detection of Food-borne Pathogens.Rapid methods for detection of Food-borne Pathogens.
Rapid methods for detection of Food-borne Pathogens.Kaleem Iqbal
 
Genomics, Transcriptomics, Proteomics, Metabolomics - Basic concepts for clin...
Genomics, Transcriptomics, Proteomics, Metabolomics - Basic concepts for clin...Genomics, Transcriptomics, Proteomics, Metabolomics - Basic concepts for clin...
Genomics, Transcriptomics, Proteomics, Metabolomics - Basic concepts for clin...Prasenjit Mitra
 
Fat Replacers/Structured Fats/Engineered Lipids
Fat Replacers/Structured Fats/Engineered LipidsFat Replacers/Structured Fats/Engineered Lipids
Fat Replacers/Structured Fats/Engineered LipidsSadanand Patel
 

Tendances (20)

Bioactive peptides
Bioactive peptidesBioactive peptides
Bioactive peptides
 
MALDI-TOF: Pricinple and Its Application in Biochemistry and Biotechnology
MALDI-TOF: Pricinple  and Its Application in Biochemistry and BiotechnologyMALDI-TOF: Pricinple  and Its Application in Biochemistry and Biotechnology
MALDI-TOF: Pricinple and Its Application in Biochemistry and Biotechnology
 
Interesterification
Interesterification Interesterification
Interesterification
 
Functional Properties
Functional PropertiesFunctional Properties
Functional Properties
 
Proteomics
ProteomicsProteomics
Proteomics
 
Lipid evaluation
Lipid evaluationLipid evaluation
Lipid evaluation
 
Metabolomics
MetabolomicsMetabolomics
Metabolomics
 
Quality assurance in milk and milk products copy
Quality assurance in milk and milk products   copyQuality assurance in milk and milk products   copy
Quality assurance in milk and milk products copy
 
UPGMA
UPGMAUPGMA
UPGMA
 
proteomics.ppt
proteomics.pptproteomics.ppt
proteomics.ppt
 
Kefir production
Kefir productionKefir production
Kefir production
 
Scoring schemes in bioinformatics
Scoring schemes in bioinformaticsScoring schemes in bioinformatics
Scoring schemes in bioinformatics
 
Proteomics
ProteomicsProteomics
Proteomics
 
Characterization of protein
Characterization of proteinCharacterization of protein
Characterization of protein
 
Rapid methods for detection of Food-borne Pathogens.
Rapid methods for detection of Food-borne Pathogens.Rapid methods for detection of Food-borne Pathogens.
Rapid methods for detection of Food-borne Pathogens.
 
Milk protein casein, whey protein.
Milk protein casein, whey protein.Milk protein casein, whey protein.
Milk protein casein, whey protein.
 
Protein database
Protein databaseProtein database
Protein database
 
Microbial enzymes in food processing
Microbial enzymes in food processingMicrobial enzymes in food processing
Microbial enzymes in food processing
 
Genomics, Transcriptomics, Proteomics, Metabolomics - Basic concepts for clin...
Genomics, Transcriptomics, Proteomics, Metabolomics - Basic concepts for clin...Genomics, Transcriptomics, Proteomics, Metabolomics - Basic concepts for clin...
Genomics, Transcriptomics, Proteomics, Metabolomics - Basic concepts for clin...
 
Fat Replacers/Structured Fats/Engineered Lipids
Fat Replacers/Structured Fats/Engineered LipidsFat Replacers/Structured Fats/Engineered Lipids
Fat Replacers/Structured Fats/Engineered Lipids
 

En vedette

mass spectrometry for pesticides residue analysis- L3
mass spectrometry for pesticides residue analysis- L3mass spectrometry for pesticides residue analysis- L3
mass spectrometry for pesticides residue analysis- L3sherif Taha
 
Fish Identification Course
Fish Identification Course Fish Identification Course
Fish Identification Course usfws
 
mass spectrometry for pesticides residue analysis- L2
mass spectrometry for pesticides residue analysis- L2mass spectrometry for pesticides residue analysis- L2
mass spectrometry for pesticides residue analysis- L2sherif Taha
 
Dating Fossils And Rocks
Dating Fossils And RocksDating Fossils And Rocks
Dating Fossils And Rockswhittumjd
 
mass spectrometry for pesticides residue analysis- L1
mass spectrometry for pesticides residue analysis- L1mass spectrometry for pesticides residue analysis- L1
mass spectrometry for pesticides residue analysis- L1sherif Taha
 
Mass Spectrometry Applications and spectral interpretation: Basics
Mass Spectrometry Applications and spectral interpretation: BasicsMass Spectrometry Applications and spectral interpretation: Basics
Mass Spectrometry Applications and spectral interpretation: BasicsShreekant Deshpande
 
Ensuring You're Not The Weak Link In Food Traceability
Ensuring You're Not The Weak Link In Food TraceabilityEnsuring You're Not The Weak Link In Food Traceability
Ensuring You're Not The Weak Link In Food TraceabilityAudioEducator
 

En vedette (20)

Analytical Technologies for the Identification of Food Fraud and Authenticati...
Analytical Technologies for the Identification of Food Fraud and Authenticati...Analytical Technologies for the Identification of Food Fraud and Authenticati...
Analytical Technologies for the Identification of Food Fraud and Authenticati...
 
mass spectrometry for pesticides residue analysis- L3
mass spectrometry for pesticides residue analysis- L3mass spectrometry for pesticides residue analysis- L3
mass spectrometry for pesticides residue analysis- L3
 
Fish Identification Course
Fish Identification Course Fish Identification Course
Fish Identification Course
 
Rapid Detection of Pesticides in Fruit Juice without Sample Preparation - Wat...
Rapid Detection of Pesticides in Fruit Juice without Sample Preparation - Wat...Rapid Detection of Pesticides in Fruit Juice without Sample Preparation - Wat...
Rapid Detection of Pesticides in Fruit Juice without Sample Preparation - Wat...
 
Discovery and Analysis of Peanut Allergens using Proteomic approaches with Io...
Discovery and Analysis of Peanut Allergens using Proteomic approaches with Io...Discovery and Analysis of Peanut Allergens using Proteomic approaches with Io...
Discovery and Analysis of Peanut Allergens using Proteomic approaches with Io...
 
Analysis of Mycotoxins by UPLC and Tandem Quadrupole Mass Spectrometry - Wate...
Analysis of Mycotoxins by UPLC and Tandem Quadrupole Mass Spectrometry - Wate...Analysis of Mycotoxins by UPLC and Tandem Quadrupole Mass Spectrometry - Wate...
Analysis of Mycotoxins by UPLC and Tandem Quadrupole Mass Spectrometry - Wate...
 
mass spectrometry for pesticides residue analysis- L2
mass spectrometry for pesticides residue analysis- L2mass spectrometry for pesticides residue analysis- L2
mass spectrometry for pesticides residue analysis- L2
 
Overview of Food Allergen Detection using Mass Spectrometry - Waters Corporat...
Overview of Food Allergen Detection using Mass Spectrometry - Waters Corporat...Overview of Food Allergen Detection using Mass Spectrometry - Waters Corporat...
Overview of Food Allergen Detection using Mass Spectrometry - Waters Corporat...
 
Dating Fossils And Rocks
Dating Fossils And RocksDating Fossils And Rocks
Dating Fossils And Rocks
 
Mass spectrometer
Mass spectrometerMass spectrometer
Mass spectrometer
 
mass spectrometry for pesticides residue analysis- L1
mass spectrometry for pesticides residue analysis- L1mass spectrometry for pesticides residue analysis- L1
mass spectrometry for pesticides residue analysis- L1
 
Mass Spectrometry Applications and spectral interpretation: Basics
Mass Spectrometry Applications and spectral interpretation: BasicsMass Spectrometry Applications and spectral interpretation: Basics
Mass Spectrometry Applications and spectral interpretation: Basics
 
The use of High Resolution Mass Spectrometry and Statistical Analysis in the ...
The use of High Resolution Mass Spectrometry and Statistical Analysis in the ...The use of High Resolution Mass Spectrometry and Statistical Analysis in the ...
The use of High Resolution Mass Spectrometry and Statistical Analysis in the ...
 
Investigating Fruit Juice Authenticity using MS - Waters Corporation Food Res...
Investigating Fruit Juice Authenticity using MS - Waters Corporation Food Res...Investigating Fruit Juice Authenticity using MS - Waters Corporation Food Res...
Investigating Fruit Juice Authenticity using MS - Waters Corporation Food Res...
 
Rapid evaporative ionisation mass spectrometry (REIMS) for Food applications ...
Rapid evaporative ionisation mass spectrometry (REIMS) for Food applications ...Rapid evaporative ionisation mass spectrometry (REIMS) for Food applications ...
Rapid evaporative ionisation mass spectrometry (REIMS) for Food applications ...
 
Mass spectrometry
Mass spectrometryMass spectrometry
Mass spectrometry
 
Ensuring You're Not The Weak Link In Food Traceability
Ensuring You're Not The Weak Link In Food TraceabilityEnsuring You're Not The Weak Link In Food Traceability
Ensuring You're Not The Weak Link In Food Traceability
 
The Analysis of Allergens in Raw and Roasted Peanuts using Nanoscale UPLC & T...
The Analysis of Allergens in Raw and Roasted Peanuts using Nanoscale UPLC & T...The Analysis of Allergens in Raw and Roasted Peanuts using Nanoscale UPLC & T...
The Analysis of Allergens in Raw and Roasted Peanuts using Nanoscale UPLC & T...
 
materias
materiasmaterias
materias
 
Intro-Internationalization
Intro-InternationalizationIntro-Internationalization
Intro-Internationalization
 

Similaire à Identification of Meat Species in Processed Foods using Mass Spectrometry - Waters Corporation Food Research

Can LCMSMS be used in horse meat detection?
Can LCMSMS be used in horse meat detection?Can LCMSMS be used in horse meat detection?
Can LCMSMS be used in horse meat detection?SCIEX
 
Signature Peptide MRM Optimization Made Easy for Therapeutic Protein and Pept...
Signature Peptide MRM Optimization Made Easy for Therapeutic Protein and Pept...Signature Peptide MRM Optimization Made Easy for Therapeutic Protein and Pept...
Signature Peptide MRM Optimization Made Easy for Therapeutic Protein and Pept...SCIEX
 
Tools for improved Protein Mass Spec Sample preparation by Promega
Tools for improved Protein Mass Spec Sample preparation by PromegaTools for improved Protein Mass Spec Sample preparation by Promega
Tools for improved Protein Mass Spec Sample preparation by PromegaMourad FERHAT, PhD
 
Quantitative Analysis of Transporter Protein using TripleTOF® 6600 System
Quantitative Analysis of Transporter Protein using TripleTOF® 6600 SystemQuantitative Analysis of Transporter Protein using TripleTOF® 6600 System
Quantitative Analysis of Transporter Protein using TripleTOF® 6600 SystemSCIEX
 
Hydrolysate Characterization Technical Presentation Webinar11 2009
Hydrolysate Characterization Technical Presentation Webinar11 2009Hydrolysate Characterization Technical Presentation Webinar11 2009
Hydrolysate Characterization Technical Presentation Webinar11 2009Mason Williams
 
Comprehensive Investigation of the Utilization of SFC/ESI Positive Mode MS fo...
Comprehensive Investigation of the Utilization of SFC/ESI Positive Mode MS fo...Comprehensive Investigation of the Utilization of SFC/ESI Positive Mode MS fo...
Comprehensive Investigation of the Utilization of SFC/ESI Positive Mode MS fo...Waters Corporation
 
Animal species specific quantification of gelatin with TrustGel
Animal species specific quantification of gelatin with TrustGelAnimal species specific quantification of gelatin with TrustGel
Animal species specific quantification of gelatin with TrustGelAnne Kleinnijenhuis
 
Protein Thermal Shift™ Solution Using Applied Biosystems Real-Time PCR Systems
Protein Thermal Shift™ Solution Using Applied Biosystems Real-Time PCR SystemsProtein Thermal Shift™ Solution Using Applied Biosystems Real-Time PCR Systems
Protein Thermal Shift™ Solution Using Applied Biosystems Real-Time PCR SystemsThermo Fisher Scientific
 
In-silico Proteolysis of food
In-silico Proteolysis of foodIn-silico Proteolysis of food
In-silico Proteolysis of foodShamim Hossain
 
Protein Qualitative Analysis Services
Protein Qualitative Analysis ServicesProtein Qualitative Analysis Services
Protein Qualitative Analysis ServicesCreative Proteomics
 
Proteomics & Metabolomics
Proteomics & MetabolomicsProteomics & Metabolomics
Proteomics & Metabolomicsgumccomm
 
Recombinant protein expression and purification Lecture
Recombinant protein expression and purification LectureRecombinant protein expression and purification Lecture
Recombinant protein expression and purification Lecturetest
 
High throughput, data independent acquisition for qualitative and quantitativ...
High throughput, data independent acquisition for qualitative and quantitativ...High throughput, data independent acquisition for qualitative and quantitativ...
High throughput, data independent acquisition for qualitative and quantitativ...SCIEX
 
Peptide Mass Fingerprinting (PMF) and Isotope Coded Affinity Tags (ICAT)
Peptide Mass Fingerprinting  (PMF) and Isotope Coded Affinity Tags (ICAT)Peptide Mass Fingerprinting  (PMF) and Isotope Coded Affinity Tags (ICAT)
Peptide Mass Fingerprinting (PMF) and Isotope Coded Affinity Tags (ICAT)Suresh Antre
 
Biosimilar Development Regulatory, Analytical, and Clinical Considerations
Biosimilar Development Regulatory, Analytical, and Clinical Considerations Biosimilar Development Regulatory, Analytical, and Clinical Considerations
Biosimilar Development Regulatory, Analytical, and Clinical Considerations SGS
 

Similaire à Identification of Meat Species in Processed Foods using Mass Spectrometry - Waters Corporation Food Research (20)

Can LCMSMS be used in horse meat detection?
Can LCMSMS be used in horse meat detection?Can LCMSMS be used in horse meat detection?
Can LCMSMS be used in horse meat detection?
 
Analysis of Milk and Egg Allergens in Wine using UPLC-MS - Waters Corporation...
Analysis of Milk and Egg Allergens in Wine using UPLC-MS - Waters Corporation...Analysis of Milk and Egg Allergens in Wine using UPLC-MS - Waters Corporation...
Analysis of Milk and Egg Allergens in Wine using UPLC-MS - Waters Corporation...
 
Signature Peptide MRM Optimization Made Easy for Therapeutic Protein and Pept...
Signature Peptide MRM Optimization Made Easy for Therapeutic Protein and Pept...Signature Peptide MRM Optimization Made Easy for Therapeutic Protein and Pept...
Signature Peptide MRM Optimization Made Easy for Therapeutic Protein and Pept...
 
Tools for improved Protein Mass Spec Sample preparation by Promega
Tools for improved Protein Mass Spec Sample preparation by PromegaTools for improved Protein Mass Spec Sample preparation by Promega
Tools for improved Protein Mass Spec Sample preparation by Promega
 
Quantitative Analysis of Transporter Protein using TripleTOF® 6600 System
Quantitative Analysis of Transporter Protein using TripleTOF® 6600 SystemQuantitative Analysis of Transporter Protein using TripleTOF® 6600 System
Quantitative Analysis of Transporter Protein using TripleTOF® 6600 System
 
Hydrolysate Characterization Technical Presentation Webinar11 2009
Hydrolysate Characterization Technical Presentation Webinar11 2009Hydrolysate Characterization Technical Presentation Webinar11 2009
Hydrolysate Characterization Technical Presentation Webinar11 2009
 
Mtr corporate
Mtr corporateMtr corporate
Mtr corporate
 
Comprehensive Investigation of the Utilization of SFC/ESI Positive Mode MS fo...
Comprehensive Investigation of the Utilization of SFC/ESI Positive Mode MS fo...Comprehensive Investigation of the Utilization of SFC/ESI Positive Mode MS fo...
Comprehensive Investigation of the Utilization of SFC/ESI Positive Mode MS fo...
 
Animal species specific quantification of gelatin with TrustGel
Animal species specific quantification of gelatin with TrustGelAnimal species specific quantification of gelatin with TrustGel
Animal species specific quantification of gelatin with TrustGel
 
Protein Thermal Shift™ Solution Using Applied Biosystems Real-Time PCR Systems
Protein Thermal Shift™ Solution Using Applied Biosystems Real-Time PCR SystemsProtein Thermal Shift™ Solution Using Applied Biosystems Real-Time PCR Systems
Protein Thermal Shift™ Solution Using Applied Biosystems Real-Time PCR Systems
 
protea ILMAC 07 -cam
protea ILMAC 07 -camprotea ILMAC 07 -cam
protea ILMAC 07 -cam
 
In-silico Proteolysis of food
In-silico Proteolysis of foodIn-silico Proteolysis of food
In-silico Proteolysis of food
 
Protein Qualitative Analysis Services
Protein Qualitative Analysis ServicesProtein Qualitative Analysis Services
Protein Qualitative Analysis Services
 
Proteomics & Metabolomics
Proteomics & MetabolomicsProteomics & Metabolomics
Proteomics & Metabolomics
 
Recombinant protein expression and purification Lecture
Recombinant protein expression and purification LectureRecombinant protein expression and purification Lecture
Recombinant protein expression and purification Lecture
 
Peptide mapping
Peptide mappingPeptide mapping
Peptide mapping
 
VTT's Emilia Nordlund: Bioprocessing as a tool to improve the functionality o...
VTT's Emilia Nordlund: Bioprocessing as a tool to improve the functionality o...VTT's Emilia Nordlund: Bioprocessing as a tool to improve the functionality o...
VTT's Emilia Nordlund: Bioprocessing as a tool to improve the functionality o...
 
High throughput, data independent acquisition for qualitative and quantitativ...
High throughput, data independent acquisition for qualitative and quantitativ...High throughput, data independent acquisition for qualitative and quantitativ...
High throughput, data independent acquisition for qualitative and quantitativ...
 
Peptide Mass Fingerprinting (PMF) and Isotope Coded Affinity Tags (ICAT)
Peptide Mass Fingerprinting  (PMF) and Isotope Coded Affinity Tags (ICAT)Peptide Mass Fingerprinting  (PMF) and Isotope Coded Affinity Tags (ICAT)
Peptide Mass Fingerprinting (PMF) and Isotope Coded Affinity Tags (ICAT)
 
Biosimilar Development Regulatory, Analytical, and Clinical Considerations
Biosimilar Development Regulatory, Analytical, and Clinical Considerations Biosimilar Development Regulatory, Analytical, and Clinical Considerations
Biosimilar Development Regulatory, Analytical, and Clinical Considerations
 

Plus de Waters Corporation - Food QC, Safety & Research

Plus de Waters Corporation - Food QC, Safety & Research (11)

Oasis® Prime HLB - introducing a new sorbent for the sample cleanup of Food m...
Oasis® Prime HLB - introducing a new sorbent for the sample cleanup of Food m...Oasis® Prime HLB - introducing a new sorbent for the sample cleanup of Food m...
Oasis® Prime HLB - introducing a new sorbent for the sample cleanup of Food m...
 
Stevia - Analytical LC/MS methods from research to routine - Waters Corporati...
Stevia - Analytical LC/MS methods from research to routine - Waters Corporati...Stevia - Analytical LC/MS methods from research to routine - Waters Corporati...
Stevia - Analytical LC/MS methods from research to routine - Waters Corporati...
 
Routine Quantification of Pesticides in Food Matrices using UPLC APGC-MSMS - ...
Routine Quantification of Pesticides in Food Matrices using UPLC APGC-MSMS - ...Routine Quantification of Pesticides in Food Matrices using UPLC APGC-MSMS - ...
Routine Quantification of Pesticides in Food Matrices using UPLC APGC-MSMS - ...
 
Foodomics Applications with High Resolution MS - Waters Corporation Food Res...
Foodomics Applications with High Resolution MS -  Waters Corporation Food Res...Foodomics Applications with High Resolution MS -  Waters Corporation Food Res...
Foodomics Applications with High Resolution MS - Waters Corporation Food Res...
 
Food Contact Materials: Migration testing using MS - Waters Corporation Food ...
Food Contact Materials: Migration testing using MS - Waters Corporation Food ...Food Contact Materials: Migration testing using MS - Waters Corporation Food ...
Food Contact Materials: Migration testing using MS - Waters Corporation Food ...
 
Rapid Analysis of Bisphenols (BP) A, B & E in Baby Food and Infant Formula - ...
Rapid Analysis of Bisphenols (BP) A, B & E in Baby Food and Infant Formula - ...Rapid Analysis of Bisphenols (BP) A, B & E in Baby Food and Infant Formula - ...
Rapid Analysis of Bisphenols (BP) A, B & E in Baby Food and Infant Formula - ...
 
An Integrated Strategy for Natural Biotoxin analysis - Waters Corporation - F...
An Integrated Strategy for Natural Biotoxin analysis - Waters Corporation - F...An Integrated Strategy for Natural Biotoxin analysis - Waters Corporation - F...
An Integrated Strategy for Natural Biotoxin analysis - Waters Corporation - F...
 
Ion Mobility MS for the troubleshooting of methods for Trace Residue Quantita...
Ion Mobility MS for the troubleshooting of methods for Trace Residue Quantita...Ion Mobility MS for the troubleshooting of methods for Trace Residue Quantita...
Ion Mobility MS for the troubleshooting of methods for Trace Residue Quantita...
 
Use of APGC coupled to Tandem Quadrupole Mass Spectrometry for the analysis o...
Use of APGC coupled to Tandem Quadrupole Mass Spectrometry for the analysis o...Use of APGC coupled to Tandem Quadrupole Mass Spectrometry for the analysis o...
Use of APGC coupled to Tandem Quadrupole Mass Spectrometry for the analysis o...
 
The Advantages of Mass Detection for the Food Testing Laboratory - Waters Cor...
The Advantages of Mass Detection for the Food Testing Laboratory - Waters Cor...The Advantages of Mass Detection for the Food Testing Laboratory - Waters Cor...
The Advantages of Mass Detection for the Food Testing Laboratory - Waters Cor...
 
Routine Quantification of Lipophilic Marine Biotoxins in Shellfish by LC/MS/M...
Routine Quantification of Lipophilic Marine Biotoxins in Shellfish by LC/MS/M...Routine Quantification of Lipophilic Marine Biotoxins in Shellfish by LC/MS/M...
Routine Quantification of Lipophilic Marine Biotoxins in Shellfish by LC/MS/M...
 

Dernier

POGONATUM : morphology, anatomy, reproduction etc.
POGONATUM : morphology, anatomy, reproduction etc.POGONATUM : morphology, anatomy, reproduction etc.
POGONATUM : morphology, anatomy, reproduction etc.Silpa
 
Human genetics..........................pptx
Human genetics..........................pptxHuman genetics..........................pptx
Human genetics..........................pptxSilpa
 
PSYCHOSOCIAL NEEDS. in nursing II sem pptx
PSYCHOSOCIAL NEEDS. in nursing II sem pptxPSYCHOSOCIAL NEEDS. in nursing II sem pptx
PSYCHOSOCIAL NEEDS. in nursing II sem pptxSuji236384
 
GBSN - Microbiology (Unit 3)
GBSN - Microbiology (Unit 3)GBSN - Microbiology (Unit 3)
GBSN - Microbiology (Unit 3)Areesha Ahmad
 
Conjugation, transduction and transformation
Conjugation, transduction and transformationConjugation, transduction and transformation
Conjugation, transduction and transformationAreesha Ahmad
 
300003-World Science Day For Peace And Development.pptx
300003-World Science Day For Peace And Development.pptx300003-World Science Day For Peace And Development.pptx
300003-World Science Day For Peace And Development.pptxryanrooker
 
Biogenic Sulfur Gases as Biosignatures on Temperate Sub-Neptune Waterworlds
Biogenic Sulfur Gases as Biosignatures on Temperate Sub-Neptune WaterworldsBiogenic Sulfur Gases as Biosignatures on Temperate Sub-Neptune Waterworlds
Biogenic Sulfur Gases as Biosignatures on Temperate Sub-Neptune WaterworldsSérgio Sacani
 
Grade 7 - Lesson 1 - Microscope and Its Functions
Grade 7 - Lesson 1 - Microscope and Its FunctionsGrade 7 - Lesson 1 - Microscope and Its Functions
Grade 7 - Lesson 1 - Microscope and Its FunctionsOrtegaSyrineMay
 
Chemistry 5th semester paper 1st Notes.pdf
Chemistry 5th semester paper 1st Notes.pdfChemistry 5th semester paper 1st Notes.pdf
Chemistry 5th semester paper 1st Notes.pdfSumit Kumar yadav
 
Call Girls Ahmedabad +917728919243 call me Independent Escort Service
Call Girls Ahmedabad +917728919243 call me Independent Escort ServiceCall Girls Ahmedabad +917728919243 call me Independent Escort Service
Call Girls Ahmedabad +917728919243 call me Independent Escort Serviceshivanisharma5244
 
Exploring Criminology and Criminal Behaviour.pdf
Exploring Criminology and Criminal Behaviour.pdfExploring Criminology and Criminal Behaviour.pdf
Exploring Criminology and Criminal Behaviour.pdfrohankumarsinghrore1
 
COMPUTING ANTI-DERIVATIVES (Integration by SUBSTITUTION)
COMPUTING ANTI-DERIVATIVES(Integration by SUBSTITUTION)COMPUTING ANTI-DERIVATIVES(Integration by SUBSTITUTION)
COMPUTING ANTI-DERIVATIVES (Integration by SUBSTITUTION)AkefAfaneh2
 
Bhiwandi Bhiwandi ❤CALL GIRL 7870993772 ❤CALL GIRLS ESCORT SERVICE In Bhiwan...
Bhiwandi Bhiwandi ❤CALL GIRL 7870993772 ❤CALL GIRLS  ESCORT SERVICE In Bhiwan...Bhiwandi Bhiwandi ❤CALL GIRL 7870993772 ❤CALL GIRLS  ESCORT SERVICE In Bhiwan...
Bhiwandi Bhiwandi ❤CALL GIRL 7870993772 ❤CALL GIRLS ESCORT SERVICE In Bhiwan...Monika Rani
 
Zoology 5th semester notes( Sumit_yadav).pdf
Zoology 5th semester notes( Sumit_yadav).pdfZoology 5th semester notes( Sumit_yadav).pdf
Zoology 5th semester notes( Sumit_yadav).pdfSumit Kumar yadav
 
Pulmonary drug delivery system M.pharm -2nd sem P'ceutics
Pulmonary drug delivery system M.pharm -2nd sem P'ceuticsPulmonary drug delivery system M.pharm -2nd sem P'ceutics
Pulmonary drug delivery system M.pharm -2nd sem P'ceuticssakshisoni2385
 
Bacterial Identification and Classifications
Bacterial Identification and ClassificationsBacterial Identification and Classifications
Bacterial Identification and ClassificationsAreesha Ahmad
 
module for grade 9 for distance learning
module for grade 9 for distance learningmodule for grade 9 for distance learning
module for grade 9 for distance learninglevieagacer
 
Module for Grade 9 for Asynchronous/Distance learning
Module for Grade 9 for Asynchronous/Distance learningModule for Grade 9 for Asynchronous/Distance learning
Module for Grade 9 for Asynchronous/Distance learninglevieagacer
 

Dernier (20)

POGONATUM : morphology, anatomy, reproduction etc.
POGONATUM : morphology, anatomy, reproduction etc.POGONATUM : morphology, anatomy, reproduction etc.
POGONATUM : morphology, anatomy, reproduction etc.
 
+971581248768>> SAFE AND ORIGINAL ABORTION PILLS FOR SALE IN DUBAI AND ABUDHA...
+971581248768>> SAFE AND ORIGINAL ABORTION PILLS FOR SALE IN DUBAI AND ABUDHA...+971581248768>> SAFE AND ORIGINAL ABORTION PILLS FOR SALE IN DUBAI AND ABUDHA...
+971581248768>> SAFE AND ORIGINAL ABORTION PILLS FOR SALE IN DUBAI AND ABUDHA...
 
Human genetics..........................pptx
Human genetics..........................pptxHuman genetics..........................pptx
Human genetics..........................pptx
 
PSYCHOSOCIAL NEEDS. in nursing II sem pptx
PSYCHOSOCIAL NEEDS. in nursing II sem pptxPSYCHOSOCIAL NEEDS. in nursing II sem pptx
PSYCHOSOCIAL NEEDS. in nursing II sem pptx
 
GBSN - Microbiology (Unit 3)
GBSN - Microbiology (Unit 3)GBSN - Microbiology (Unit 3)
GBSN - Microbiology (Unit 3)
 
Conjugation, transduction and transformation
Conjugation, transduction and transformationConjugation, transduction and transformation
Conjugation, transduction and transformation
 
300003-World Science Day For Peace And Development.pptx
300003-World Science Day For Peace And Development.pptx300003-World Science Day For Peace And Development.pptx
300003-World Science Day For Peace And Development.pptx
 
Biogenic Sulfur Gases as Biosignatures on Temperate Sub-Neptune Waterworlds
Biogenic Sulfur Gases as Biosignatures on Temperate Sub-Neptune WaterworldsBiogenic Sulfur Gases as Biosignatures on Temperate Sub-Neptune Waterworlds
Biogenic Sulfur Gases as Biosignatures on Temperate Sub-Neptune Waterworlds
 
Grade 7 - Lesson 1 - Microscope and Its Functions
Grade 7 - Lesson 1 - Microscope and Its FunctionsGrade 7 - Lesson 1 - Microscope and Its Functions
Grade 7 - Lesson 1 - Microscope and Its Functions
 
Chemistry 5th semester paper 1st Notes.pdf
Chemistry 5th semester paper 1st Notes.pdfChemistry 5th semester paper 1st Notes.pdf
Chemistry 5th semester paper 1st Notes.pdf
 
Call Girls Ahmedabad +917728919243 call me Independent Escort Service
Call Girls Ahmedabad +917728919243 call me Independent Escort ServiceCall Girls Ahmedabad +917728919243 call me Independent Escort Service
Call Girls Ahmedabad +917728919243 call me Independent Escort Service
 
Exploring Criminology and Criminal Behaviour.pdf
Exploring Criminology and Criminal Behaviour.pdfExploring Criminology and Criminal Behaviour.pdf
Exploring Criminology and Criminal Behaviour.pdf
 
COMPUTING ANTI-DERIVATIVES (Integration by SUBSTITUTION)
COMPUTING ANTI-DERIVATIVES(Integration by SUBSTITUTION)COMPUTING ANTI-DERIVATIVES(Integration by SUBSTITUTION)
COMPUTING ANTI-DERIVATIVES (Integration by SUBSTITUTION)
 
Bhiwandi Bhiwandi ❤CALL GIRL 7870993772 ❤CALL GIRLS ESCORT SERVICE In Bhiwan...
Bhiwandi Bhiwandi ❤CALL GIRL 7870993772 ❤CALL GIRLS  ESCORT SERVICE In Bhiwan...Bhiwandi Bhiwandi ❤CALL GIRL 7870993772 ❤CALL GIRLS  ESCORT SERVICE In Bhiwan...
Bhiwandi Bhiwandi ❤CALL GIRL 7870993772 ❤CALL GIRLS ESCORT SERVICE In Bhiwan...
 
Zoology 5th semester notes( Sumit_yadav).pdf
Zoology 5th semester notes( Sumit_yadav).pdfZoology 5th semester notes( Sumit_yadav).pdf
Zoology 5th semester notes( Sumit_yadav).pdf
 
PATNA CALL GIRLS 8617370543 LOW PRICE ESCORT SERVICE
PATNA CALL GIRLS 8617370543 LOW PRICE ESCORT SERVICEPATNA CALL GIRLS 8617370543 LOW PRICE ESCORT SERVICE
PATNA CALL GIRLS 8617370543 LOW PRICE ESCORT SERVICE
 
Pulmonary drug delivery system M.pharm -2nd sem P'ceutics
Pulmonary drug delivery system M.pharm -2nd sem P'ceuticsPulmonary drug delivery system M.pharm -2nd sem P'ceutics
Pulmonary drug delivery system M.pharm -2nd sem P'ceutics
 
Bacterial Identification and Classifications
Bacterial Identification and ClassificationsBacterial Identification and Classifications
Bacterial Identification and Classifications
 
module for grade 9 for distance learning
module for grade 9 for distance learningmodule for grade 9 for distance learning
module for grade 9 for distance learning
 
Module for Grade 9 for Asynchronous/Distance learning
Module for Grade 9 for Asynchronous/Distance learningModule for Grade 9 for Asynchronous/Distance learning
Module for Grade 9 for Asynchronous/Distance learning
 

Identification of Meat Species in Processed Foods using Mass Spectrometry - Waters Corporation Food Research

  • 1. ©2015 Waters Corporation 1 Identification of Meat Species in Processed Foods using Mass Spectrometry
  • 2. ©2015 Waters Corporation 2 Presentation Overview  Background – Food labelling regulations – Water retaining agents in chicken products – Use of gelatine  Research Objectives  Proposed solution – Sample preparation procedure – LC-MS approach – Data interpretation  Results – Identification of potential peptide markers – Quantification of markers  Future work using Xevo TQ-S  Conclusions
  • 3. ©2015 Waters Corporation 3 Meat speciation – regulatory requirements  Authenticity of food and the accuracy of package labeling is important to both consumers and food producers  Within the EC food labeling regulations exist – ~5 M people in UK have preferences concerning consumption of certain species  Composition of injection powders? – Undeclared water-retaining hydrolysed proteins from pork and beef used in chicken products – Some chicken products potentially unsuitable for consumers  Need to verify the species of gelatine used in food
  • 4. ©2015 Waters Corporation 4 Injection powders - gelatine  What is it? – Bi-product from the meat / fish industry – partial hydrolysis of collagen extracted from skin, bones, connective tissue  Properties of gelatine – Gelling agent – Semi-solid colloid gel – Texture enhancer  Approx annual production: – Europe: 117kt (70% used in food)  What is it used for? – Food and Beverages – Drugs and capsules – Cosmetics – Photographic film – Fertilisers…
  • 5. ©2015 Waters Corporation 5 Research objectives and aims  Develop a method to detect species and tissue origin of meat ingredients present in meat products 1. To identify unequivocal markers that can indicate the presence of bovine or porcine gelatine 2. To determine whether chicken products have been adulterated with proteins from other animal species 3. To develop a robust and transferable method  Current limitations… – Paper trail is not sufficient – FSA concluded that PCR / IA based strategies are not reliable • DNA markers damaged by processing conditions • False negative rate  Possible Solutions? – LC-MS/MS using a proteomic workflow
  • 6. ©2015 Waters Corporation 6 Alternative strategy = proteomic based analytical strategy to identify peptide markers using HR-MS
  • 7. ©2015 Waters Corporation 7 Bottom-up proteomic experiment 1. Enzyme digestion 2. UPLC separation Precursor ions MSE product ions 3. MS analysis 4. Data interpretation
  • 8. ©2015 Waters Corporation 8 Meat Speciation Workflow SAMPLE PREPARATION (1) Tryptic digest (2) ADH addition DATA ACQUISITION Acquire data-independent MSE Data SOFTWARE PROCESSING IdentityE and gelatine database (BioArch) ANALYTICAL SYSTEMS (1) nanoACQUITY UPLC ® (2) XevoTM QTof MS Nano-scale separations •Resolution •Peak shape •Number of components / analytical run Full scan, accurate mass
  • 9. ©2015 Waters Corporation 9 Meat Speciation Workflow Sample Preparation  Samples – Protein tryptic digests; o pork gelatine o beef gelatine o pork & beef gelatine mix  Tryptic digest – 250 μg of porcine and bovine gelatine were hydrolysed with 5 μg of sequence grade trypsin for 16hr  ADH addition – Quench reaction with formic acid – 10 fmol of yeast alcohol dehydrogenase (internal standard) added tryptic digest SAMPLE PREPARATION (1) Tryptic digest (2) ADH addition
  • 10. ©2015 Waters Corporation 10 UPLC Conditions  System – NanoACQUITY® UPLC  Column: – 75 µm x 15 cm BEH C18 column  Gradient: – 1 to 40% acetonitrile – 90 min  Flow rate: – 300 nL/min  Triplicate analysis MS Conditions  System – Xevo QTof MS  Mass range: – m/z 50-1990  Data Acquisition: – MSE  Collision energy: – Low energy - 4 eV – High energy - 12-35 eV  Acquisition scan time: – 0.9 s/function Meat Speciation Workflow UPLC-MS conditions OPTIMISED ANALYTICAL PARAMETERS (1) nanoACQUITY UPLC ® (2) XevoTM QTof MS
  • 11. ©2015 Waters Corporation 11 Meat Speciation Workflow MSE  UPLC-MSE is a data independent parallel process that occurs in the collision cell  The instrument is operated in an alternative scanning mode providing two MS scan functions for data acquisition in one analytical run – Function 1 = low collision energy (precursor ions) Function 2 = high energy (fragment ions) DATA ACQUISITION Acquire data-independent MSE Data
  • 12. ©2015 Waters Corporation 12 Meat Speciation Workflow Software processing SOFTWARE PROCESSING PLGS and IdentityE Positive matches referenced to database library Increasing confidence in assignment of peptides
  • 13. ©2015 Waters Corporation 13 Results and Discussion
  • 14. ©2015 Waters Corporation 14 nanoACQUITY replicate injections (n=3) Beef gelatine Repeatable results Overlay low energy MSE chromatograms
  • 15. ©2015 Waters Corporation 15 Meat Speciation Workflow Software processing High energy product ion data gives increased confidence in peptide sequence identification Low energy data can be displayed as a mass spectrum or a chromatogram Markers originated from a SINGLE protein Unique marker peptides sequences listed here
  • 16. ©2015 Waters Corporation 16 Discovery & Identification Total Marker Peptides Aim to obtain a peptide marker that is unmodified (if possible)  Over 60 collagen peptides were identified in samples of both bovine and porcine gelatines  IdentityE did not identify peptides from any other proteins – Collagen – Yeast ADH  Indicates the samples were 100% gelatine Multiple forms of the peptides identified Species peptide Peptide mass Type of peptide modification Bovine GYPGNPGPAGAAGAP 1235.58 Non-tryptic cleavage product GYPGNPGPAGAAGAPGPQGAVGPAGK 2173.08 Unmodified peptide GYPGNPGPAGAAGAPGPQGAVGPAGK 2189.07 Hydroxyl of single proline GYPGNPGPAGAAGAPGPQGAVGPAGK 2205.07 Hydroxylation of prolines 3 and 15 GYPGNPGPAGAAGAPGPQGAVGPAGK 2221.06 Three hydroxyprolines GYPGNPGPAGAAGAPGPQGAVGPAGKHGNR 2653.3 Missed tryptic cleavage hydroxylation of proline 29 GYPGNPGPAGAAGAPGPQGAVGPAGKHGNR 2669.29 Missed cleavage plus two proline hydroxylations Porcine IGQPGAVGPAGIR 1192.68 Deamidation + Q3 IGQPGAVGPAGIR 1193.66 Hydroxyl + DKNP 4 IGQPGAVGPAGIR 1208.67 IGQPGAVGPAGIR 1209.66 Deamidation +Q3; Hydroxyl+DKNP9
  • 17. ©2015 Waters Corporation 17 Discovery & Identification Unique Unmodified Marker Peptides Bovine peptide marker IGQPGAVAPAGIR Porcine peptide marker TGQPGAVAPAGIR Comparison of high energy MSE fragment ion spectra Differences in b and y ions formed
  • 18. ©2015 Waters Corporation 18 Quantification Porcine and bovine gelatine  Use of ADH enabled quantification of proteins in sample Removes need to use labelling systems for peptide and protein quantification Test mix was prepared Addition of 15%(w/w) bovine gelatine in porcine gelatine Results Three bovine and porcine peptides were selected - relative bovine gelatine content of ~ 16.8%
  • 19. ©2015 Waters Corporation 19 Conclusions  Highly processed food proteins, such as gelatine, that are devoid of DNA signature can be speciated using LC-MS  Protein sequence database analysis identified peptide sequences within the protein that are species specific  Waters Xevo Qtof MS was able to identify these sequences, even after significant modification of the amino acids  The interrogation of the total protein complement of the sample also provided potential information on non-gelatine proteins in the samples
  • 20. ©2015 Waters Corporation 20 Further Work Preliminary data suggests the method can be used to quantify the species in mixtures of gelatines  Investigate the contribution that type III collagen (from skin and connective tissue) might make to the quantitative analysis of gelatines
  • 21. ©2015 Waters Corporation 21 Future Work Method transfer to routine analysis using tandem quad MS/MS
  • 22. ©2015 Waters Corporation 22 Acknowledgments Helen Grundy - Food and Environment Research Agency, York, UK BioArCh, University of York, UK Thank you for your attention Any Questions?