SlideShare une entreprise Scribd logo
1  sur  44
Télécharger pour lire hors ligne
Argumentative Essay On Welfare
Writing an argumentative essay on the topic of welfare can be a challenging task that requires
careful consideration of various perspectives and a thorough understanding of the subject matter.
The topic itself is multifaceted, involving complex issues related to social, economic, and
political aspects. Crafting a well-reasoned argument requires extensive research to gather relevant
information and data to support your claims.
One of the difficulties lies in navigating the sensitive nature of the welfare system. The topic
often involves discussions on poverty, inequality, government policies, and societal
responsibilities. Addressing these issues requires a nuanced approach to ensure that your
arguments are well-grounded, respectful, and considerate of diverse viewpoints.
Furthermore, constructing a coherent and persuasive thesis statement is essential in an
argumentative essay. It should clearly articulate your stance on the topic while setting the stage
for the subsequent development of your arguments. Formulating strong arguments and
counterarguments, supported by credible evidence, demands critical thinking and analytical
skills.
In addition, maintaining a logical flow throughout the essay is crucial. Transitioning seamlessly
between different points and sections while maintaining clarity and coherence can be a
challenge. Striking the right balance between presenting facts and incorporating your own
analysis is another aspect that requires careful attention.
Despite the challenges, writing an argumentative essay on the welfare topic can be a rewarding
experience. It allows you to engage with important societal issues, develop your analytical skills,
and enhance your ability to articulate and defend your opinions.
For those seeking assistance with essays on various topics, including argumentative essays on
welfare, there are resources available. Websites likeHelpWriting.net offer services where you
can order custom essays tailored to your specific requirements. These services can provide
support in structuring your essay, conducting research, and ensuring that your arguments are
well-developed. Keep in mind that while seeking assistance can be helpful, it's important to
maintain academic integrity and ensure that the work aligns with your own understanding and
perspective on the topic.
Argumentative Essay On WelfareArgumentative Essay On Welfare
The Importance Of Investment In A Website
Why is investing in a website a good step for your business? Here are great reasons
why you need to have a website. The investment you make in your website is a
sustainable investment (your site exists as long as you renew the hosting and the
domain name), especially if you opt for a solution that offers an easy to use interface
and allows to evolve your site at the same timeas your activity.
In our connected world, many shopping decisions are made at a computer screen.
Imagine those customers you may have lost because you don t have a website. A web
page can then become a very important source of information about everything that
affects your products and services for your customers.
People from all over can find your website and ... Show more content on
Helpwriting.net ...
Today, it s also easy to use a website to advertise and increase your visibility. Also, by
setting up the right tools (payment buttons, forms, automated procedures, etc.) you
can get prospects and customers at any time of the day and even during the holidays.
It is also an element that will bring you more credibility. Your website is an
investment and not an expense. In the short and medium term, you will see the
benefits of a website. And your website can also help you defeat your rivals.
An about page allows you to tell your readers who you are, the goal of your website
and the experience you have. This is a very important page that can help you
quickly win credibility in the eyes of a surfer who arrives on your website for the
first time.
Is there any affiliate program that you would like to promote? For example, a
customer s garden is in great need of landscaping and they have a lot of flyers of
landscaping companies. Therefore, the first reflex may be to check the information
that they found on the internet about these landscaping companies. Imagine your
customer who bought 5 years ago at home, do you think he would like new
information?
Your clientele is no longer limited to people in your city or region. Your site is the
center of your online presence. Your website is your anchor, your home on the
internet.
A website
Bank
LESSON 14: CASH BOOK, PASS BOOK, BANK RECONCILIATION
STATEMENT Dr. Jyotsna Sethi, Rekha Rani STRUCTURE 14.1 Introduction
14.2 Objectives 14.3 Cash Book 14.4 Types of Cash Book 14.4.1 Simple Cash
Book 14.4.2 Two Column Cash Book 14.4.3 Three Column Cash Book 14.5 Petty
Cash Book. 14.5.1. Imprest System of Petty Cash Book. 14.5.2 Advantages of Petty
Cash Book 14.6 Pass Book 14.7. Bank Reconciliation Statement 14.7.1 Meaning
14.7.2. Causes for difference between Cash Book Balance and Pass Book Balance.
14.7.3. Need and importance of Bank Reconciliation Statement 14.7.4 Procedure for
preparation of Bank Reconciliation Statement. 14.8. 14.9. Summary Glossary 14.10.
Self Assessment Questions 14.11. Answer to check your progress 14.12.... Show more
content on Helpwriting.net ...
Dec 2 Dec 3 Dec 4 Dec 5 Dec 6 Cash in Hand Received from Ramesh Purchased
Furniture Machinery Sold Goods sold Salaries paid Rs. 10,000 13,000 15,000 10,000
20,000 1,000 .............................................................................................
.............................................................................................
.............................................................................................
.............................................................................................
............................................................................................. 14.4.2. TWO COLUMN
CASH BOOK A two column cash back records discount allowed and discount
received along with the cash payments and cash receipts. Discount allowed is the
concession given by the businessman to its customers or debtors e.g. if a debtor has
to pay Rs. 10,000 and he is allowed 10% discount, now he will pay only Rs. 9000 to
the firm. This is called discount allowed, it is a type of loss for the business so it
is to be debited and recorded in Dr. Side of the cash book. Discount received is the
concession received by the business man from the creditors. e.g. if a firm has to
pay Rs. 50,000 to its creditors and discount received is 20% then the firm has to
pay only Rs. 40,000 to the creditor. This is called discount received, it is a gain or
profit for the firm so it is to be credited and recorded in the Cr. side of the cash book
the specimen Performa of a two column cash Book is given as under Two column
Cash Book Dr Date Receipts Particulars Amount Dis. Amount Cash Date Payments
Particular Amt. Dis. Cr Amt. Cash 213 Note: Discount columns are not balanced they
are merely totaled. Example 2: Enter the following
The Correlation Between Sex Tourism And Prostitution
Tourism has been a major contributor to the economic, social and human
development of Morocco. Its social and economic impacts such as the reduction of
unemployment and poverty are clearly evident in today s society. With a growth of
6.0% in its tourism compared to the world average growth rate of 1.6%, the success
of the Moroccan tourism sector is without any doubts astonishing. In fact, tourism has
become one of the most important sectors for Morocco. It is said that the reasons
behind this success are mainly due to the development and implementation of new
policies under the reign of the monarch, King Mohammed IV, and the development of
certain industries such as agriculture and textile. In this paper, however, I argue that
there are other factors behind Morocco s rapid development in the tourism industry
that are ignored due to social and religious reasons. In order to demonstrate this point,
I will examine the predominance of sex tourism and prostitution in Morocco and how
they play a major role in the development and success of tourism. Finally, I contend
that the tourism sector is not sustainable as its social and economic impacts have
already started affecting negatively the social life of the Moroccan population. Unless
an alternative of sustainable tourism is put in place, this growth in the tourism
industry will disappear leading to unprecedented and unwanted consequences. Before
examining the sex tourism in Morocco, let us first look at its starting point. The
Empathy Star Trek
Star Trek: TNG and the Cultivation of Empathy
In this paper, I argue that watching Star Trek: The Next Generation cultivates
empathy. Empathy is a good that human beings ought to develop and having a sense
of empathy is one of the best things in life. Empathy consists in the capacity to
understand what another person is going through from their perspective. The reason
that a sense of empathy is one of the best things in life is that it is impossible to have
deep and meaningful relationships with others when we don t have empathy. Without
empathy, we inevitably turn inward and live a lonely life. For this reason, empathy is
one of the best things in life.
Regular watching of Star Trek: TNG increases our capacity for empathy. The reason
why this is the case is that watching acts ... Show more content on Helpwriting.net ...
Now characters in Star Trek: TNG routinely show empathetic concern for one
another. For instance, when a race of cyborgs capture Jean Luc Picard (captain of the
Enterprise on the show), the crew of the
Enterprise do everything in their power to rescue Picard. One of their main
motivations for rescuing
Picard is their experience of the sense of distress that he experiences while in
captivity. This is just one instance where empathy is shown in the program, but it
happens on a regular basis. In sum, watching
Star Trek: TNG increases our capacity for empathy because the characters regularly
display empathy on the show and because we tend to imitate the actions that we see
other human beings performing.
Someone might object to this argument by pointing out that characters on the show
also display cruelty that involves a lack of empathy. For instance, in one episode a
malevolent being kills one of the members for the crew for no apparent reason. If we
watch this cruelty, then perhaps we ourselves might behave more cruelly. But this
objection can be refuted. Cruelty on the show is always shown in
Reflective Essay On Leadership
Leadership is such a simple term for such a complex phenomenon. As a child, I can
remember adult phrases like natural born leader that contributed to my naГЇve notion
of how leaders are preordained at birth with the gifts or qualities necessary for
leadership, or at the very least nurtured by parents who were natural leaders. As a
result, I never truly felt natural when called into leadershippositions throughout my
life.
As a teenager, I was confused when both adults and peers called me to be their
leader. At sixteen, I finally felt confident enough to try out for cheerleading. Not
only was I given a position on the basketball cheer squad both my junior and senior
year of high school, but I was also voted to be team captain unanimously both
years. But why? What did they see which I did not? A similar curious posture came
when a member of Forbes UMC s, my home church, nomination committee
approached me about becoming an education committee member at age seventeen.
But why? Again and again I was called up to lead in my small social contexts.
College was no different as my second year of cheerleading found our squad in
need of a new captain as the senior captain stepped down from leadership for
academic reasons. Again, it was a unanimous vote. But why? I stress the unanimous
verdicts not to boast, but to highlight a reflection I had not considered until now.
Every time I asked But why? to my leaders and coaches they all answered in a similar
way. My dedication to the cause
Russia in World War One Essay
Russia in World War One Against a domestic background of widespread strikes and
violent government assaults on strikers, Russia entered WWI in August, 1914. with
the world s largest army. Poorly trained and equipped, they quickly went from early
success to catastrophic defeat. The disastrous fortunes of the Russian army
undermined the authority of the government. There were conscription (draft) riots in
the cities. There were food shortages. Russialost territory. People who did not
oppose the war because of political sentiments opposed it because they saw it as a
disaster for the Russian people. By the end of 1916, the Russians had lost more than
a million men and continued to lose major... Show more content on Helpwriting.net ...
The Bolsheviks agreed to help but made it clear they were fighting against
Kornilov s troops and not in support of the government. In just a few days, they
raised an armed militia of 25,000 and fortified the city. Kornilov s soldiers refused
to try to take Petrograd by force. Kornilov was arrested, his general commited
suicide, and Kerensky had a new problem on his hands.
The Bolsheviks now had control of the Soviets and the Red Guard, control of
Petrograd, and a small but well organized and armed militia. The Mensheviks had
allied themselves with Kerensky, Kerensky had tried to broker a deal with the
landowners, and had sent the Cossacks out to subdue the revolutionaries in the
countryside. None of this was well received by the workers. At the urging of Trotsky,
the Red Guards stormed the Winter Palace, Kerensky ran to France, and the
Bolsheviks were now in control.
But wasn t Trotsky on the side of the Mensheviks?
He had been, but he was one of many who were greatly angered by the Mensheviks
support of Kerensky. He was by now a pacifist as far as the war was concerned, a
believer in permanent revolution, and totally opposed to Kerensky s alliances with
the propertied classes. So he joined with the Bolsheviks when he returned to Russia
from his long and turbulent exile abroad. He was instrumental in
Alexander Gideon Lightwood Research Paper
Esther Yang Archery 9:00 9:50 AM Alec Lightwood Alexander Gideon Lightwood
or as he calls himself, Alec, is a kick butt, sexy looking Shadowhunter from the
book series The Mortal Instruments. He was born in Idris in September 1989 and
the eldest child of Robert and Maryse Lightwood. His siblings are Isabelle Sophia,
Max Joseph (Rest his soul), and his adopted brother Jace Lightwood Herondale.
Soon after he was born, he and his family were exiled from Idris, because his
parents had joined with a rebel group called, The Circle of Raziel. An occult like
group whose purpose was to purify the world of demons, magical creatures, and all
species of Downlorders for the human kind. His family now runs the New York
Institute for the Shadowhunter council as their punishment and where he and his
siblings grew up together. Shadowhunters or also known as Nephilim have existed
since the rise of human kind. They are a secret race of humans born with angelic
blood. Specifically, the Angel Raziel s blood that he poured into a chalice called the
Mortal Cup for his chosen followers to drink from to gain powers to fight demons
and the other dark creatures. This race of humans are stronger, smarter, faster, and
have the ability to see past the veil that hides the Downlorder world from the human
world through the use of... Show more content on Helpwriting.net ...
For instance, His sister, Isabelle s choice of weapon is an electrum laced whip and
his brother Jace prefers to use swords. Alec s preferred choice of weapon is the
bow and arrow. He is the only one in his family who has chosen the bow and arrow
as his choice in weaponry. A majority of Shadowhunters use close quarter weapons
to decapitate and kill their opponents, so it is rare that a Shadowhunter would choose
a long range weapon as a
Pieta Michelangelo
On March 6, Michelangelo was brought into this world by his mother, Francesca di
Neri del Miniato di Siena, and his father, Ludovico di Leonardo Buonarroti Simoni,
in Caprese, Italy in 1475. His mother pasted away in 1481, when he was just six
years old; during that time, he was placed with a family of stonecutters. Later on
Michelangelos father realized that his son had no interest in the family business,
therefore, at the age of 13, he engaged to the Florentine painter s workshop. There
he was introduced to the painter Domenico Ghirlandaio, and he was exposed to the
technique of fresco. When Michelangelo was 21 years old, he arrived in Rome on
June 25, 1496. On the fourth of July of that same year, he began to work on the over
life size... Show more content on Helpwriting.net ...
It was known as one of the world s great masterpieces of sculpture, and it was
finished when he was 24 years old. Michelangelo s Pieta is now displayed at the
Vatican City, in St. Peter s Basilica after being moved over 5 times while it is six
feet wide and nearly as tall. He returned to Florence in 1499. He took over the
statue of David, which two sculptors had previously attempted, but left him
unfinished. Michelangelo responded by completing his most famous work in
1504. David stands 17 feet tall and it stands on an 8 foot pedestal. In 1505, he
Michelangelo was invited to come back to Rome by the Pope Julius II. He was
given the job to build the Pope s tomb, which was to include 40 statues and be
finished in a total of 5 years. Although he worked on it for 40 years, it was never
truly finished to his satisfaction. During that same time period, in 1508, Michelangelo
painted the ceiling of the Sistine Chapel. It took him approximately 4 years to
complete. The composition stretches over 500 square meters of ceiling and contains
over 300 figures. He revealed the finished work on October 31,
A Comparison Of The Glass Menagerie
While reading Tennessee Williams play, The Glass Menagerie , readers are drawn
into the drama and disaster that is the Wingfield family. There were several different
film and television versions of this play done thru the years from 1950 to 1987. After
watching several different adaptations, Paul Newman s film adaptation in 1987 is
extremely faithful to the written version. Focusing on plot, setting, and character
development the audienceis introduced to a familywith an austere future structured
around a series of abandonments, difficulty accepting reality and the impossibility
of true escape. Both versions begin with a narrator looking back at the past and
setting the stage for what memories will follow. The story is told in hindsight by
Tom. It begins with Laura and Amanda waiting at the dining table for Tom to join
them, so they can say grace and begin the meal, showing the audience, the family is
very close and depend on each other. Throughout, readers also see constant conflict
between the mother and children, but never conflict between the siblings. For
instance, when Williams writes after an argument between Tom and Amanda;
AMANDA: I won t speak to you until you apologize! (25) then the next morning
Amanda sending Laura out, so she can talk to Tom privately to discuss Laura s
future. Trying to provide security to Laura and Amanda (at Amanda s request), Tom
invites and friend, Jim, home from work to meet his sister in the hopes that he will
assume the
Guided Meditation Practices
In guided meditation, guided imagery or guided relaxation techniques, the instructor
offers suggestions to guide the listener into a meditative state. Visualization practices
can be similarly guided, or practiced on one s own. The goal of these techniques can
be relaxation, healing, uplifting emotions, inner peace or other desired outcomes.
The Transcendental Meditation technique is not guided meditation and does not
depend on a CD or any outside guide. It is not a process of bringing awareness to
the body or imagining a peaceful, relaxed state or particular goal in life. Although
guided meditation practices may create pleasant moods or degrees of relaxation,
much greater benefit comes from the process of transcending the realm of thinking ...
Show more content on Helpwriting.net ...
Guided meditation and visualization
In guided meditation practices also called guided imagery or guided relaxation a
speaker offers instruction or suggestion to guide the listener into a meditative state.
Visualization practices can be similarly guided, or practiced on one s own. The aim
can be relaxation, positive thinking, healing, inner peace or other desired outcomes.
Guided meditation and visualization tend to keep attention in the active realm of
thinking, imagining and feeling. The TM technique is not guided meditation and
does not require a CD or any outside influence. It is not an act of merely imagining a
peaceful, settled state, and its positive affect on daily life is more far reaching.
The TM technique is not guided meditation and does not require a CD or any
outside influence. It is not an act of merely imagining a peaceful, settled state, and
its positive affect on daily life is more far
The Spanish And Mexican Period
1. The story line I am going to talk about is power and oppression, throughout
California s history there has been many events of power and oppression that has
shaped California s history in many ways. I selected this storyline because I am able
to relate many of these events that have happened throughout history. I will described
the Spanish and Mexican period, the Americanization period, the early 20th century,
and the late 20th century to today.
First I will begin with the Spanish and Mexican period 1776 1846, during these
period we could see that there was a lot of power and oppression that started with the
Spanish conquest to expand their colonization. The spanish brought with them
christianity trying to convert Native Americans to become that same religion, the
spanish developed a series of presidios, missions, and pueblos in the lands of Native
Americans where they were forced to change their religion, customs, and culture to
become part of the Spanish. Many Native Americans were killed by the Spanish
soldiers when they would decline to change their way of living. The Spanish practice
oppression trying to convert this people into christianity this is an example of the
power and oppression the spanish used during these period of time. After Mexico
became independent from the Spanish empire the Mexican government took control
of California and during these period, the Mexican government put an end to the
mission/presidio system. The Mexican government allowed
The Importance Of The Conformity Of Uniforms
I researched how the conformity of uniforms in schools have violated a number of
First Amendment rights. The First Amendment of the United States was ratified,
on December 15, 1791. It promises protection for all to express their individual
freedoms of religion, speech, press, the right of assembly, and the right of petition.
These terms back in 1791 were not distinguished. Even now in the 21st Century the
words remain subjective to ongoing interpretation and debate. The placement of
uniforms in schools can discriminate against gender equality, as well as one s
sexual orientation, political views, and religion. The First Amendment was put in
place to grant these individual freedoms, yet students are expected to conform to
school policies regardless of their own beliefs. An example of this violation would
be Tinker v. Des Moines. In this court case students from a school in Des Moines,
Iowa were threatened with suspension if they went through with a plan to silently
protest the war in Vietnam. The students involved were denied their right to
peacefully assemble. It is stated in the First Amendment that Congress shall make
no law respecting an establishment of religion, or prohibiting the free exercise
thereof; or abridging the freedom of speech, or of the press; or the right of the
people peaceably to assemble, and to petition the Government for a redress of
grievances. The children who were suspended for proceeding with the plan of
peaceful protest sued the school district through their parents for a violation of their
First Amendment rights. In the District Court the judge ruled in favor of the school
district, claiming the school s actions were fair to maintain school discipline. Their
ruling, however was reversed in the Supreme Court when it was asked if the
prohibition of a form of symbolic protest, violated the students freedom of speech
guaranteed by the First Amendment? I will be using this court case to address
current issues that also violate or at least put a restriction on a student s First
Amendment rights in schools. The definition of conformity is the compliance or
acquiescence of obedience. Conformity is encouraged with a high level of visual
similarity among members of
Correlation Between The Data, And The Fitted Values Essay
Abstract We use diagnostic method to find residual and influence in nonlinear
regression for repeated measurement data. The purpose of that to detect disparity
between the data, and the fitted values as well as disparity among a few data sets.
Most of these Techniques based on graphical representation of residuals, hat matrix
and case deletion measures. After fitting a regression model, it is important to
regulate whether the entire requisite models supposition are reasonable before
performing inference. If there are any breaches, subsequent inferential procedures
may be invalid resulting in faulty conclusions. Therefore, it is crucial to perform
appropriate model diagnostic.
The one step approximation the estimates, generalized cook distance and likelihood
distance are considered. Cook and likelihood distance are two statistical diagnostics
method. Models diagnostics procedures imply both graphical and formal statistical
tests. These procedures recognize us to inspect whether the supposition of the
regression model are justifiable and decide whether we can belief subsequent
inference outcome. We use these methods to explore the performance of residual and
influence in nonlinear regression model. These residuals can produce confusing
results when used in diagnostic method corresponding to those for linear regression.
Simulation provide to
The Importance Of Organizational Intentions Among The...
The organizational expressions differ among the Spokane, Portland, Houston, and
Madison Police Departments because every police department focuses on their
purpose of organization, defines what is important to that specific police
department,and community, and establishes organizational goals to align with their
practices and values (Cordner 2016, p. 48). These organizational expressions also
differ among the departments based upon community needs and departmental
capabilities (Cordner, 2016). It is imperative that each policedepartment designs their
own mission statement to benefit police employees and citizens (Cordner, 2016). The
Spokane Police Department utilized service, pride, and dedication to provide
organizational goals to their
Change Of Milo In The Phantom Tollbooth
In the book, The Phantom Tollbooth by Norton Juster, Milo, the main character,
embarked on a journey with two others to rescue the two princesses, Rhyme and
Reason. Milo changed a great deal throughout the book. In the beginning of the
book, Milo was very ungrateful and was very unhappy. At the end of the book,
Milo is a completely different person. Milo has learned to appreciate everything
and is much happier. Milo changed at many points in the book, and I will be listing
three of them. One place where Milo changed was on page 31, when Milo took a
wrong turn and drove into the Doldrums because he was not thinking. Milo met Tock,
the watchdog of the Doldrums, who gave him some good advice. Well, continued the
watchdog impatiently, since you got here by not thinking, it seems reasonable to
expect that, in order to get out, you must start thinking. This advice caused Milo to
think more about what he was doing, thus changing him. This was an important place
where Milo changed because it is the first place in the book where he changes....
Show more content on Helpwriting.net ...
That wasn t bad at all the Humbug said, straightening his tie and brushing himself
off. I must visit there again. I m sure you will, gasped Milo. But from now on I m
going to have a very good reason before I make up my mind about something. You
can lose too much time jumping to Conclusions. In this scene, Milo changed
because he learned a lesson about the importance of having a reason before you do
something. This was an important place where Milo changed because he realized
that he hadn t had a reason for many things before he did
How Caffeine Works Not A Drug Summary
Summary This article talks about how caffeine works and how it may be considered
a drug. The article starts out by saying that billions of people are addicted to caffeine
and then explains the history of caffeine. It was originally used to protect against
insects because the amount of caffeine in plants is toxic to bugs. Then, when the
caffeinewas absorbed into nearby soil, the plant growth of nearby plants would be
hindered. Because of this more and more plants evolved to contain caffeine and
eventually it was discovered for human use in by Chinaand the Native Americans.
After this more people discovered caffeine and it has now become a multibillion
dollar industry. Then the article explains the effect caffeine has on the body.
3
Failure of IMF and World Bank Policies in Sub-Saharan
Africa
Failure of IMF and World Bank Policies in Sub Saharan Africa
Over the last several hundred years, Africa has been deprived of the peace that it so
desperately needs. For over 400 years, Africa was subjected to the harsh trans
Atlantic slave trade. Europeans and Americans brutally uprooted millions of Africans
and shipped them away. Torn away from their homes, Africans were inhumanely
exploited for their labor. The slave trade had a devastating effect not only on those
involved, but also on future generations to come. The exploitation of Africans
continued even after slavery was abolished. A new formof slavery disguised as
colonialism quickly took form as an institutionalized method of exploiting Africans.
European ... Show more content on Helpwriting.net ...
In the following essay, I will show how the policies in place now are neither working
but also making the situation worse. In order to solve the debt crisis in Africa, I
propose the following three measures:
1)The Cancellation of all external debt
2)Investments in health, education, and infrastructure
3)New trade policies to fix the disparity in trade between African countries and
industrialized nations.
New methods need to be taken in order to at least curtail the region?s downward
spiral. Cleary, the policies in place now undermine the economic development of
African countries.
The IMF and World Bank
The IMF was established in 1945 by the United Nations to improve the health of the
world economy. It was designed in order to avoid the catastrophic economic policies
that had contributed to the Great Depression in the 1930s. The IMF is an
international organization comprised of 184 member countries. It was established
with the goal in mind of promoting international monetary cooperation in order to
stimulate economic growth and provide temporary financial assistance to countries to
help alleviate problems associated with debt. Acting as the central institution of the
international monetary system, the IMF?s main objective is to prevent crises in the
system by advising countries to implement reliable economic policies. It also
provides funds that
Housewife In The 1920 s
In 1920 76.4 % of women had not yet joined the labor force. These women were
still considered to be housewives. A housewife is a woman who takes of her
home. She cooks, cleans, takes care of her kids and caters to her husbands needs.
She was to put them first and put herself last. Although being a housewife was
expected of women in the 1920s, it was not always what they wanted. Before the
1920s women were beginning to make a few changes because their husbands and
sons were off to World War One. This meant women spent their time taking their
place in the factories and other work areas, Which is less time at home and taking
care of their kids. Women s employment rates increased during WWI, from 23.6%
of the working age population in 1914 to between 37.7% and 46.7% in 1918 (TUC
collections). Showing that before the 1920s many women were working like they
never had before. Soon after, the men began to return home from war, and many
women were fired and sent back home to be housewives once again. The women
who stayed in the work field were pushed into more feminine jobs like nursing or
being a secretary.... Show more content on Helpwriting.net ...
There were things that were expectable to society and there were things that were
not acceptable. They were expected to obey their husbands, do as they say, and to
act in a manner that would uphold their husband s reputation. This included
maintaining their appearance an acting appropriately in public settings. Once the
women got married, they were expected to have children and take care of them.
These women were to stay home and cater to their child s every need. People did
not think that women had the same capabilities as men. Society did not even see
these women as intelligent as their male counterparts. Women were not offered or
even considered for the same types of jobs and they were not allowed to vote.
Society looked down on them, simply because of their
Poldark Season 3 Analysis
As Poldark season 3 continues, the show is teasing another confrontation between
Ross and George. One that has mostly been simmering in the season so far.
Poldark is not necessarily at its best when it pits Ross Poldark and George
Warleggan against each other. But, like it or not, their fates are effectively
intertwined. Much as we love Demelza and Ross and their shared scenes, it s hard to
deny that when Aidan Turner and Jack Farthing share a screen, there s generally
some high quality (melo)drama.
Fortunately, the show has not given up on pitting them against each other even with
season 3 trying to keep them apart.
In fact, Masterpiece has already put out a trailer that hints directly at the two of them
squaring off yet again, this time over Ross new favorite brother in law (though the
competition wasn t that strong, Drake ... Show more content on Helpwriting.net ...
After all, he says, the people will rise up, and I will be powerless to stop them. The
unlike last time is left unsaid, at least in this trailer, but it hangs heavy over the scene
nevertheless.
Ross does good things (sometimes), and they ve earned him some sway with people.
Unfortunately, Ross has also spent most of the season in France, traveling to France,
or thinking about France (with the exception of the winter grain purchasing, which
was mostly handled by Demelza and Caroline anyway). Meanwhile, Drake has filled
some of that popularity gap as well.
And, well, it rather seems like George can t stand any of this.
As a result, on one hand, we have Ross, finally focused on matters at home full time
and finding himself going to bat for a brother in law that got shot trying to rescue
Dwight. On the other hand, we have George, who s found himself stymied at almost
every turn.
NEXT: Riverdale: Dark Betty vs. Assertive Betty vs...Regular Betty?
We re not saying there might be a problem for George even if Drake lives, but we re
definitely thinking it very
Advantages And Disadvantages Of Sulphuric Acid
Uses of sulphuric acid
Sulphuric acid is a very useful, referred as universal chemical because it is a
commonly used chemical in the world and is used in a lot of manufacturing
industries, for example, car battery, manufacturing fertilisers, refining crude oil,
making phosphoric acid etc. This chemical is also known as one of the most
important industrial chemical. This acid has helped us in many ways, making things
easier for us.
What is sulphuric acid?
Sulphuric acid is a chemical compound, H2SO4. It is colourless, odourless and
very corrosive causing burn. It is an oily liquid and is sometimes called oil of vitriol.
Sulphuric acid can be produced by Contact Process.
Combustion Chamber
(combustion of sulphur)
Converter
(conversion ... Show more content on Helpwriting.net ...
Positive environmental impacts
This product of sulphuric acid, phosphoric fertiliser, can make fertile land. It can
help farmers by making more land for them to grow crops. More soil nutrients are
available for farmers to use. The farmers are able to use more land for farming
efficiently instead of planting in small spots. Besides, the plant growth can be
improved to protect the soil. More different plants can grow. The biodiversity can be
increased.
Negative environmental Impacts
Even though this chemical is very helpful to farmers and is good for crop
production. Over using chemical fertiliser can cause a lot of pollutions. For
example water pollution occurs when the fertilisers are washed into rivers or sea.
Besides, plants or crops do not absorb the fertiliser one hundred percent. They only
absorbs a portion of the fertilisers leaving some remaining in the soil. When the
fertiliser goes into the water, micro organism can grow like algae. This can cause
eutrophication because the algae grows faster on the fertiliser washed into the sea.
This can cause the algae to take up a lot of oxygen from the water. This can cause
lack of oxygen in the water for the fish, suffocating the fish that lives in the area. The
ecosystem will be disturbed due to the large numbers of death of
Generally, In A Political Science, The Notion Of...
Generally, in a political science, the notion of accountability can be interpreted as an
answerability of actions, and responsibility to the constituents of the government
officials (Seymour 1995, pp 9). However, there are many different kinds of ideologies
regarding the judicial accountability. Some scientists argue that the notion of
accountabilityhas the same meaning either in the political arena or in the judicial
system. Such as, Sengupta (2014) argues that, likewise accountability in the political
arena, in the judicial branch, the notion of accountability relates to the ambit of
judicial resolution, which means while making judicial decisions, judges are
responsible for their decisions, and answerable to their constituents of... Show more
content on Helpwriting.net ...
The last part of the taxonomy covers non instrumental (an exercise of power is a
basic source of accountability) and instrumental (such as disclosure of annual
income) occasions.
However, Sengupta does not clearly consider the question of to whom the judiciary
should be accountable. According to his determination about the judiciary
accountability, it can be seen that the judges and the judicial system should entirely
accountable to politicians. In this case, the notion of the Separation of power will be
rejected. Therefore, according to the notion of the separation of power, the state
power should be separated into three different, independent bodies. If the judiciary
system is accountable to the politicians (parliament), who established its institutions,
then the judicial resolutions will be influenced by the politicians.
Based on an idea of guarantees of judicial impartiality, which is an essential basis of
the democratic ideology, another scholar Daniela (2010, p.p. 24 34) considers legal,
institutional, professional, managerial and societal accountabilities of the judicial
branch. The legal accountability is formed by the notion of the rule of law, which
means 1.The State is the only subject that can control society; 2.The control should
be exercised through law; 3.The law s initial purpose is achieving social purposes;
4.Citizens have equal rights to the law;
The Emperor Penguin And The Great
The Emperor penguin and the Great norther diver they are both are from the class
Aves (Magnuson, 2007) .In addition, the emperor penguin since is in the class Aves,
the penguins used to be able to flight which is an adaptive trait. But, since they are
bigger, heavier, and better at swimming the trait was lost over time (Elliott et. al,
2013).In addition, physiologically the common loon looks different very different
from the Emperor penguinlooks bigger and can t fly. In the other hand the common
loon is small, is able to fly, swim, but can t walk (Mager et. al, 2017). Both, species
have evolve to either loss or gain traits over time to adapt to their environment. Both
species are in the same class but, have different niche in the environment. The
emperor penguin can be found in the open ice of Antarcticaand they are considered
sea ice obligate species (Fretwell et. al,2014).Emperor penguin, has an advantage in
their environment since there are no predators and completion for the resources they
eat. Moreover, their body temperature surfaces cool beneath the air temperature since
they life in a cold environment (McCafferty et al,2013).In addition, the environment
in which Emperor penguin live on is harsh, but they are the only vertebrate species
that breed during the Antarctic winter and the reason are not yet known ( Zitterbart
et. al,2014).As a result, the climate change in their habitat Emperor penguin are in
jeopardy and their population will decline since the
Lake Michigan s Radiography Program
I was excited when I was accepted into Radiologic program at Lake Michigan, a year
earlier I was very disappointed when I missed the deadline to apply into the
program because I was missing one of the required prerequisites to get into the
program. I had to wait a full year to apply again and I was very happy when I got
accepted into the program, it was hard to hide my excitement during the first
semester, I was charged and ready to go.
As part of the Radiography program, for the two years we are in the program we are
required to do clinical rotations at hospitals or clinics in the surrounding areas. They
were usually 24 hours a week during the fall and winter semesters and 40 hours a
week during spring and summer semesters. There were times I had to drive an hour
just to get to a clinical rotation. Although every semester was ... Show more content
on Helpwriting.net ...
I should have waited until I knew the people better at the new clinic before
attempting to test on the assessment. I later found out although it is not required
students who were ready to test will check they cassettes for films, because for
some reason some of the Technologist will forget or didn t care to replace the film.
As a student at a new place it is better to know the people, what they like, how they
work, and what they expect from you. I failed in both of those categories and it was
an important learning experience for me personally although the failing grade was
rescinded and I was made to retest with the same lady again.
After the assessment I reported to the Clinical Coordinator what happened and how
I felt I received the wrong grade for an assessment I passed, because someone forgot
to put a film back in the cassette. Our clinical instructor did a great job by choosing
that moment as a teaching moment for the whole
How Did Rome Influence Greek Culture
Ancient Greek history has played a vital role in cultures throughout time. From its
neighbors in Europe to all the way across the Atlantic, ancient Greece has influenced
many nations. From United States to Canada to Mexico, the influence of Greece can
still be seen today. While the influence of ancient Greeceis grand, there was one
place that was so enamored by the Greek way of life, that they seemingly adopted it
as its own. The culture of ancient Romeso closely mirrors that of ancient Greek
society that it is not uncommon to mix the two up. Since the Roman Empire did not
flourish until after the Greek downfall, it is known that the Romans were directly
influenced by the Greeks. Assimilation Of Greek cultural traditions created a
bizarre situation, in which Rome was culturally Greek, but it was culturally unique,
as it still retained influences from early Italians. While it is obvious that the
Romans were influenced by the Greeks, one may wonder when this cultural
assimilation of Greek culture began. The Roman conquest of Greece was a period
in time where The Romans and the Greeks were at war and how eventually Greece
became one of the first provinces of the emerging Roman Empire.
The Romans had an emigration for Greek culture in a sense that ... Show more content
on Helpwriting.net ...
The first are the Pyrrhic Wars and the second are the Macedonian Wars. Tarentum
was the greatest city in Italy after Rome and in the late 280 s the Romans decided
to install garrisons in several Greek cities. The citizens of Tarentum regarded this as
an imperialist move: the garrisons would be followed by a more permanent Roman
presence and accelerated Romanization (Waterfield 12). In an effort to placate the
anxious Tarentines a Roman envoy delivered a speech in Greek, to which the
Tarentines decided to mock his mishaps. With the knowledge that they would not
succeed in defeating the Romans on their own, they had to search for assistance
Aesthetic Representation
Aesthetic Representation The relationship with my patient was built upon
communication. As my patient didn t speak much English, I was able to speak to
him throughout clinical in Spanish. The Spanish language was an imperative
aspect of our relationship, being able to speak in this language allowed my patient
to freely talk to me without difficulty. Our relationship was like a book, as each
time I spoke with him about something new, I would be turning to a new page with
a different passage being read. Each of these pages are read in Spanish, as I spoke
to my patient in this language. The pages represent something I said in Spanish to
my patient during clinical. So, when a page in Spanish is turned, the next page
would be a translation into English. Patient and Clinical Experience My patient is an
86 year old male. He was admitted to 3 East with a diagnosis of sepsis caused by
Klebsiella pneumoniae. The chief complaint that brought him... Show more content
on Helpwriting.net ...
The reflections allowed me to evaluate why my patient was admitted and find
supporting facts for their diagnosis. I helped me see many different connections of
how one thing in patient s condition can affect something else. Though the clinical
reflections were long, but I do believe that they helped me a lot in understanding
the things that led to my clinical judgements. One thing that I ll do to prepare
myself for next semester is to practice all of my skills that I ve learned during CFL
clinical this semester. I believe that by practicing these skills, it will help me be
prepared to perform any skill that needs to be done during clinical. It will help
build my confidence up and help me trust myself when I m given a task to
complete. By reviewing all the skills and skill videos, it will assure myself that I
know what I m doing during future
Blitz Unit 3
Unit 3 Essay
Question # 2: Utilizing the information in the textbook (particularly Figure 11 2 and
11 3) discuss the similarities and differences between an arson and a bombing
investigation.
The sirens wailed, blue, and white lights from the wig wags flashed, as numerous
alphabet soup agents pulled their police vehicles up to the front of the hotel parking
garage. The Local PD set up an outer perimeter by blocking off street intersections
and conducted traffic control. The inner perimeter or red zone was located on the
top floor of the parking garage. EOD personnel conducting an intel briefing.
Apparently, a hotel worker reported seeing a suspicious device under the massive
hotel air conditioning unit located on the top deck of the parking ... Show more
content on Helpwriting.net ...
Arson investigators search for trace evidence such as accelerant odors, plants, or
trailers left behind at the fire scene. Bombing Investigators search for physical
evidence, explosive residue, bomb parts, or secondary devices left at the bombing
scene. The investigators also search for video evidence from security cameras in the
area.
The fourth step in the investigative process is building the case. The theory, origin,
and target of the fire or explosion is sought. Investigators use the gathered evidence
to figure out the motivation of the arsonist or bomber, and whether driven by
psychological issues, political reasons or financial gain. The technical expertise of the
arsonist or bomber, is only limited by their resources and imagination.
The most crucial aspect in both arson and bombing investigation is the
identification and arrest of the suspect. Investigators search witness and police
intelligence reports for possible leads and suspects. The physical evidence, taggants,
or micro particles left behind at the crime scene, is analyzed at a forensics
laboratory in order to trace it back to a specific business or individual. The
information gleaned from witnesses, reports, and evidence, often lead to the
identification and arrest of the
Langston Hughes Should Be Required In The Norton
Anthology...
Collectors of poetry are bias. By this I mean that more often than not when poems
are selected for collections, the works of classical writers will be prioritized over
the works of newer or more untraditional authors. That is not to say that this is a bad
thing, there is much that can be and needs to be learned from classical poets.
However, it is often overlooked how much other, more unknown writers can
contribute to the canon of poetry, especially those influenced by different racial and
ethnic backgrounds. To demonstrate my point, in this essay I shall be discussing in
detail Langston Hughes and his piece Poem and why it should be included in the
Norton Anthology of Poetry. I will contrast and compare it with Christina Rossetti s
Remember, and back up my arguments with selected quotes from Langston Hughes
essay The Negro Artist and the Racial Mountain .
To begin, Langston Hughes Poem is an example of how few words can still hold a
deeper meaning. Using repetition, punctuation, and free verse, Hughes crafted a
poem that was elegant yet powerful in its simplicity. I loved my friend. He went
away from me. There s nothing more to say. This poem ends.
Soft as it began I loved my friend
An American poet born in 1902 in Missouri, Hughes came from a family with a
past closely tied with the fight against slavery in America. In fact, race in America
was still to play a large role in his life, and be something that he had a very strong
opinion on. And it may be for
Tattoo Cultural Phenomenon
Tattoos have been around for thousands of years and tons of people today have joined
in with the trend. A article published by the Huffington Post states that Today, 36
percent of Americans 18 25 have at least one tattoo (page 1). Tattoos are now a
cultural phenomenon due to various different things and people that are making them
a phenomenon. Tattoos weren t as common 25 years ago. The Huffington Postalso
said that those body modifications were only seen on sailors, inmates, and bike gang
members (page 1). But today, you will see tattoos on the body company presidents,
accountants, doctors, managers, and more because it is something that has become
more acceptable overtime. According to the Huffington post, The start of the cultural
... Show more content on Helpwriting.net ...
The Huffington Post claims that Celebrities like Rihanna, David Beckham,
Angelina Jolie, and Adam Levine, are several examples of mainstream media
icons that have tattoos and openly display them (page 1). A cultural phenomenon
occurs when certain individuals behave a certain way merely because other
individuals do as well. Celebrities getting tattoos is a perfect example of a cultural
phenomenon because the celebrities are the individuals that started the trend and
then their fans start to get the same tattoos because it considered cool since the
celebrities did it first, causing a bandwagon effect. The people who are getting
tattoos come from all walks of life. The canvases are teenagers and young adults,
women, African Americans, Latin Americans, urbanites, suburbanites, white collar
professionals,and the college educated. As you can tell there is a diverse group of
people that are getting tattoos, it s not just one culture getting them so having
tattooed bodies is something that is becoming more popular for all cultures and is
also becoming a trend that everyone wants to be a part of. Tattoos are a big cultural
phenomenon in today s world, because they are something that everyone can get and
they are something that helps people express themselves and they are a way for
people to show their creativity. People are getting tattoos everyday and that trend will
continue for many years to come because people like
helmet law Essay
Who are Relmets Really Protecting?
The debate over whether or not to wear a helmet while riding a motorcycle has
been hot topic since the helmet law went into effect in California in 1992. It seems
obvious that wearing a helmet would help protect you in a motorcycle accident.
Many legislatures agree. In fact, nineteen states have a mandatory helmet law for all
motorcycle riders. Twenty seven states have a law for those under a set age, three of
which require additional insurance for those of age who choose not to wear a helmet.
That leaves only four states with absolutely no helmet laws. Despite these facts,
helmets are a superficial means of safety at realistic speeds. Yet because this is a
public policy issue that is not just about ... Show more content on Helpwriting.net ...
Insurance companies are in the business of making money. It s the opinion of the
insurance companies that if a rider wears a helmet, he or she is safer and less likely to
suffer serious injuries in an accident. Fewer injuries equal fewer claims and more
profit for the company. It s not very hard to see why insurance companies are
supportive of the helmet law.
My own opinion in regards to support of the helmet law is this: very little is
presented by major medical research that would indicate that one is safer on a
motorcycle wearing a helmet during an accident. Most research states that a helmet is
only successful from preventing serious injury while driving less than 15 mph (DOT
Helmet test, 1999). Most accidents on a motorcycle occur at a higher rate of speed
making the helmet useless. In fact, accidents involving helmeted riders often result in
serious neck trauma even when the helmet doesn t come in contact with any foreign
objects.
The National Highway Traffic Safety Administration (NHTSA) web site lists that
there were a total of 323 motorcycle fatalities in California in the year 2002 (DOT
California, 2002. Of those 323, 274 were wearing a helmet, 45 riders were not. Not
the type of numbers that would make you strap on a helmet. Wearing a helmet often
times provides a false sense of security. The risk of injury and even death is very
high while riding a motorcycle. The NHTSA also points out that the majority
A Wonderful Monograph By Melissa Archer
Introduction
This is a wonderful monograph by Melissa Archer with a comprehensive study of
the theme of worship in the Apocalypse . It illustrates various aspects of worship and
the role of worship in the Apocalypse. The language of the book and different
approaches to the theme are appreciated, because those are simple and clear to
understand the theme.
Summary of the book
The context of the book is well organized. Archer divides her text into five chapters,
and every chapter has an introduction and a summery, which is really helpful to read
and get the message at the first glance.
Chapter one is a survey of modern scholarly literature related to the theme of
worship in the Apocalypse. It is divides into four subtopics; A) The theme of
worship as a whole, B) The hymns in the Apocalypse, C) Revelation 4 5, D)
Additional worship scenes.
Chapter two is focused on the methodology for the study engaging North American
Pentecostalism and Pentecostal hermeneutics. In this chapter she introduces the term
Wirkungsgeschichte ; how to discover the worship in the Apocalypse.
Chapter three is a careful reading of the early Pentecostal periodical materials. She
explains how the worship practices of early Pentecostals using both the Wesleyan
Holiness and the Finished Work traditions during the time period of 1906 1916.
Chapter four is focused on a sustained narrative reading of the Apocalypse with the
theme of worship. In addition to the prologue and epilogue, there are four
What Was The Potato Famine
Was the Potato Famine an accident? It had little to do with the declines in food
production. The bad seasons were the cause of the death that happened during this
time. You would think that the main cause of the potato famine would be plant
disease, but England s long running political hegemony over Irelandwas a huge factor.
Since the demand for potato s was higher there was a greater need to supply more,
and so then everyone started on the frenzy for potato s. When there was a strain of
Phytophthora infestation caused the widespread devastation of potato crops in
Ireland and Northern Europe. The system started to fail, and the demand for food
(potato s) became greater, and then the supply of them was not met.
During this time there
The Implementation Of Credit Rating Agencies
Credit Rating Agencies (CRAs) have also been blamed for their role in promoting
risk taking behaviour. The Basel II Accord (2004) also gave CRAs a major role to
play in financial markets. The complexity of MBSs and CDOs increased overtime,
making it difficult for the agencies to assess their risk accurately. They
underestimated the complexity of these mortgages and were slow in downgrading the
ratings during bad times, so that their ratings misled the market participants.
Overtime, various institutions made loans without verifying income and offered
floating rate mortgages with payments that were affordable only initially but
increased greatly overtime. Subprime lending became a norm rather than an
exception. Eventually borrowers ... Show more content on Helpwriting.net ...
The structure had always carried the risk of the crisis going global. Investor
confidence stumbled globally, the negative sentiment spread throughout the market
and no one wanted to buy these securities, leading to a crash in their prices. Banks,
having to use Mark to Market accounting practices, were forced to write down
losses on these securities into their balance sheets. This resulted in large losses
across the banking industry in the third and fourth quarters of 2007 (Tiller, 2010).
Bear Stearns finally collapsed on March 16, 2008 and was later sold to JP Morgan
Chase.
Lehman Brothers, one of the major investment banks in the US, held massive
amounts of CDOs and MBSs in their portfolio and was therefore nearing bankruptcy.
The CRAs gave the bank the ultimatum to find a buyer or else face a cut in its
ratings. Lehman Brothers ultimately filed for bankruptcy on September 14, 2008 due
to its inability to raise capital or find a buyer. They had expected that the government
would bail them out but that did not happen. This came up as the first big blow to the
financial markets.
There was another instrument that aggravated the whole situation. These were the
unregulated, over the counter derivatives, including Credit Default Swaps (CDSs),
that were sold as an insurance against default on MBSs. AIG sold huge amounts of
these insurance policies, without having enough money to back them up when
EMail Privacy Rights In Business Essay
E mail Privacy Rights In Business
I.Abstract
How far we have come in such a small time. When you think that the personal
computer was invented in the early 1980 s and by the end of the millennium, several
households have two PC s, it is an astonishing growth rate. And, when you consider
business, I can look around the office and see that a lot of the cubicles contain more
than one PC. It is astonishing to me that such an item has taken control over the
information technology arena like personal computers. Consider, however, the items
that go along with personal computers: printers; modems; telephone lines for your
modem; scanners; the software; online access; and lets not forget, e mail addresses.
E mail, or electronic ... Show more content on Helpwriting.net ...
Among these dangers is privacy, in particular, what legal rights corporations and
employees have in keeping their communications private. This paper will introduce
the current legislation in this area, the expectation of privacy an employee should
have, any court decisions that provide additional ruling, and what a corporation can
do to prevent litigation in these matters.
II.Employees Expectation of Privacy in e mail
As an e mail systems manager, I was under the impression that since the company
owns the electronic messaging system, the company could view the contents of any
employees e mail account at any time. I was only partially right. The explanation of
the current law will describe this in detail, but, the employee does have a certain
right to privacy where e mail is concerned.
Arguably, a company s most valuable asset is it s data. In the age of technological
marvels, it is easier to create more valuable data and, on the other hand, that data is
more easily retrievable, especially by persons not authorized to obtain the data.
Employees of companies can expect a certain right of privacy granted by three main
sources: (1) The United States Constitution; (2) Federal Statutes (The Electronic
Communications Privacy Act of 1986); and (3) State Statutes (many of which have
not addressed the issue).
The United States Constitution provides a limited group of employees with privacy
safeguards. The safeguards are based
The Death Of A Star
Palacios 1
Kimberly Palacios
English 1A 60
Professor Kathleen Gurnett
29 October 2015 Just Like Humans
If a person was to be asked to describe our life stages, they would probably say
something like people are born, they live, and then they die. Of course, they aren t
wrong, but we humans go through beautiful stages before reaching death. We go
through stages such as infancy, childhood, adolescence, and adulthood. In many
ways, Stars are just like humans. They also go through astonishing stages, all leading
up to its death. The death of a star will probably be one of the most beautiful and
terrifying moments we wont get to witness. But our sun being such a key factor in
our everyday life, is reason enough to know the importance of its life cycle and the
process it will undertake as it begins to perish. But in order to understand how and
why a star dies we first must ask ourselves: what exactly makes up a star?
We might look at the sun and think Hmm, well it just looks like a big ball of fire to
me. Good! The sun is a big ball of fire, but it doesn t burn exactly like fire, it s more
a burning glow. This glowing heat, which is about 10,000 degrees Fahrenheit, is not
produced by burning like in a chemical reaction but rather by fusion like in a nuclear
reaction. Now, to understand how the sun enters the final stage of its life cycle, it is
important we fully understand how the sun was created. For humans, one of the
earliest stages of life is birth. A human is
Art Spiegelman s Maus
A remarkable work, awesome in its conception and execution... at one and the same
time a novel, a documentary, a memoir, and a comic book. Brilliant, just brilliant.
Jules Feiffer (1)
This is a commentary by Jules Feiffer about Maus , which is a survivor s tale created
by Art Spiegelman. As you can see from the commentary, this is a wonderful story,
not only its the writing but also the art. The author made the story interesting that
attracts many readers by changing many things from the first 3 page version of Maus.
To analyse this story, first of all, we need to understand about the writing of this story.
Spiegelman focuses on many things in this story and the events in 1940s made them
connected. In chapter 1, Vladek is a ... Show more content on Helpwriting.net ...
The author wanted to focus on the emotion of characters who lived in this period.
Because this is a graphic novel, the art is also an important things to analyse. It can
support the character s emotion in the writing. While the first story is painted
cartoonishly because it s a bedtime story for children, the latter one is painted
realistically. It makes sense with the style of writing. Spiegelman didn t write
realistically but the art is cartoonish. Realistic art can show the real emotion of the
characters. As we can see in chapter 2, when Vladek spilled his pill box twice, his
face and his action showed embarrassment. When the author wrote about the
difficult times in the 1940s, the painting represented the difficult life condition.
The way that he drew a rat when Vladek and Anja lived in Kawka s cellar was very
meaningful. In Western countries, rat is the animal that many people scared. In
general, it s hard to find a rat in a Western s house. So this was a really hard life
condition of Vladek s family. We can also see that although Vladek was very
scared with rat, he still kept Anja pacing. Readers can understand clearly about not
only Vladek and Anja s hard condition but also the true love of Vladek to Anja. It
supports many things that were focused in writing. In this manner, the images are
fitted together classically. Each is drawn in a square and the script is above. It
makes readers easy to read the writing and see the picture. It isn t a very
Rhetorical Speech In Tamburlaine The King By William...
B
orn only two months before Shakespeare and dead before he was thirty, Christopher
Marlowe, considered to be the first English tragic poet, began and ended his literary
work while Shakespeare was still at the beginning. His earliest tragedy, Tamburlaine
the Great, was a path opener for the possibilities of Elizabethan tragedy. It was
followed by other three tragedies, Dr Faustus, The Jew of Malta, and Edward II. In
the prologue to his first piece, Tamburlaine, the playwright announced his intention to
use in tragedy high astounding terms. Arrogantly, he denounced the jigging veins of
rhyming mother wits who had previously been devoted to tragedy.
In spite of his wide literary studies and sympathies, Marlowe was a rebel in essence.
He ... Show more content on Helpwriting.net ...
This read: Tamburlaine the Great. Who, from a Scythian shepherd by his rare and
wonderful conquests became a most puissant and mighty monarch, and (for his
tyranny, and terror in war) was termed The Scourge of God. Divided into two
tragical discourses, as they were sundry times showed upon stages in the City of
London by the right honourable the Lord Admiral his servants. In addition, Part II
s emphasizes were later given the following description: The second part of the
bloody conquests of mighty Tamburlaine. With his impassionate fury for the death
of his lady and love, fair Zenocrate, his form of exhortation and discipline to his
three sons, and the manner of his own death. Rare and wonderful conquests by a
shepherd turned monarch, notorious for his tyranny and terror in war this is the
kind of tragedy implied by this extended tide. One of the later reprints added a
heading that reads The Tragical Conquests of Tamburlaine still another indication of
how flexibly the adjective could be applied. Rather than referring primarily to a
formal or structural pattern, or even to a disaster that follows a protagonist, tragical
linked to discourses and conquests denoted a style or a quality. Marlowe s short but
characterizing prologue to Part I includes a similar
Baz Luhrmann
Romeo and Juliet is a classic well known play, a tale of two lovers that cannot be
together. Many books, plays, and movies have based off of this then directors have
remade it into their own visions. Two films that we have seen were different
interpretations of this play one being by Franco Zeffirelli in 1968 and Baz
Luhrmann 1997. In the case of interping and showing what Shakespeare would
have wanted to see I think Franco Zeffirelli had shown it better. He showed what
the characters were truly like and how they lived. Franco s set was during the
renaissance period in the city of Verona, while Baz Luhrmann was in the present
day. The director used the setting to make it a more serious with themes of
romance and tragedy. I feel as if that was what Shakespeare was going for to make
it a serious topic as it has a powerful message. Baz Luhrmann was creating a
different point of view on the story as if it was told today. Though Shakespearean
plays had outfits of the current day in their time, Shakespeare wrote it for medieval
or early renaissance times. Franco was showing a current day for that time showing
the true origins of the story.... Show more content on Helpwriting.net ...
There were some moving shots to help catch the action happening to the
characters. In Baz Luhrmann s movie he has the camera moving many times
zooming in a characters face or onto something else. This caused a more whimsical
feel, we are not able to focus on something causing more confusion. It takes away
the darkness of the story and instead shows more joy and fun. The movie was in a
more cool tone compared to Baz Luhrmann who had the movie in a warm tone most
of the time. This gave the audience a more calm and serious feeling showing us more
the dark lives the characters
The Pros And Cons Of African Americans In Reconstruction
The Civil War ended in 1865 and while the thirteenth amendment was being passed
lots of African Americans faced problems. With the death of Abraham Lincoln,
Andrew Johnson became president and while he worked with Lincoln he lacked
Lincoln s critical thinking and thought that African Americans shouldn t be
involved in reconstruction. The definition of freedom is the power or right one
has to speak and think as one wants without restraint. Although African Americans
were still being treated like vermin by whites and struggled economically they
were politically free. In the year 1866, the Civil rights act was passed and it
allowed African Americans to own property and be treated equally in court. The
only problem with that was the south refused to obey the laws. Once Johnson
pulled all the men out of the south who were suppose to protect the rights of
African Americans everything fell apart. Henry Adams was traveling and six
miles south of town he was beaten by four white men with sticks. The men
threatened to kill every Negro that claimed he did not belong to anyone.On his way
to Shreveport, he noticed twelve colored men and women beat, shot and hung (
doc D). So, while blacks were free many people in the South believed the there way
of life was better and continued to treat African Americans poorly. It got to the point
where President Johnson came up with new rules for African Americans that they
would abide by. These new rules were called the Black Codes (C). The Black
Protein Based Ligands For Tumor Targeting
In addition to peptides, protein based ligands such as Affibody proteins have been
utilized for tumor targeting. Anti epidermal growth factor receptor (EGFR)
Affibody protein (e.g., Ac Cys ZEGFR:1907, amino acid sequence: Ac
CVDNKFNKEMWAAWEEIRNLPNLNGWQMTAFIASLVDDPSQSANLLAEAKKLNDAQ
NH2) is used to target EGFR that is overexpressed in a wide variety of human
tumors. Cheng and co workers used anti EGFR Affibody proteinas tumortargeting
ligand on 64Cu Au IO nanoparticles (PET component: 64Cu, MRI component: iron
oxide, specific for EGFR) surface.[63] In their work, A431 tumor cells were
subcutaneously implanted in the right shoulders of nude mice; and 64Cu NOTA Au
IONP Affibody nanoparticles were administered via tail vain injection. Rather low
resolution PET image showed that these nanoparticles were taken by EGFR positive
A431 (human epithelial carcinoma cell line) cells reaching 4.6% ID/g at 24 h after
injection, significantly higher than that obtained from the blocking experiment
(1.9% ID/g) indicating the specificity of the probe. This difference in % ID/g values
corroborated with 44% drop in MRI signal intensity that was observed for the tumor.
In this study, the use of an Affibody protein as ligand for EGFR expressing tumor in
small animals was demonstrated to be successful; however, the benefit of
multimodality was not demonstrated. The unique chemistry of this dumbbell shaped
Au IO nanoprobe could pave the way for targeted drug delivery into EGFR
expressing tumors
Censorship Of The World Wide Web
We live in the age of information, a world that has now been largely digitalized.
The World Wide Web is the central component of our era, as it allows people across
the globe to share and receive information in an instance. It used to take months
before a letter from China could reach the U.S, now it just takes a second with E
Mail. This fast pace information processing has allowed human society to move
forward with unprecedented speed, but it also raises many concerns for government
authorities. Sharing information is a powerful tool, and too much of it will make any
government nervous.
Censorship of information has had a long history throughout the world. In ancient
China for example, censorship was considered a legitimate instrument ... Show more
content on Helpwriting.net ...
That is a 718% increase compared with the 757 items that Google had to remove in
the six months prior (Suter). Dorothy Chou, a senior policy analyst at Google
wrote in her blog post, It s alarming not only because free expression is at risk, but
because some of these requests come from countries you might not suspect Western
democracies not typically associated with censorship. Other countries can also send
in requests to Google and ask them to take things down, but Google rarely complies
with those requests. Being a U.S based company; Google has complied with 93% of
the government requests from our own government authorities. It only complied or
partially complied with only 24% of such requests from Canada, and 44% from
France (Sutter). The numbers are significantly lower, which shows that Google is
clearly under more pressure by the U.S government. Other nations like China and
Russia have completely banned Google all together.
These data suggests that the U.S government also actively monitors the World Wide
Web, George Orwell s worst nightmare. The U.S. government has even gone as far
as to ask Google for data on its users more than 31,000 times in 2012 alone. Google
said that they ended up turning over at least some data in every single case (Quain).
However, some have argued that these monitoring isn t all that bad. Censorship to
some extent, as some would argue, is to
The Big Data Related Activities
The world is changing with respect to the growth in big data and to the way in
which it is used. Growth in big data brings with it many challenges, but it also
presents new opportunities. Figure 1, helps understand some of the big data
related activities that are taking place in the world with respect to volume of data
that is being consumed by these activities over the next 5 years. Fig. 1: Data is
predicted to grow to more than 160,000 terabytes in the next 5 years. Apple was
Teradata s fastest ever customer to a petabyte and, is operating a multiple petabyte
Teradata system. Walmart s operational system was at 3 petabytes as of 2009, and
uses separate ones for Walmart, Sam s Club and a backup system as well. eBay s
primary data... Show more content on Helpwriting.net ...
Retailers are partnering with data providers and consumer databases to meet
customer experience expectations. It is important for brands to stand out as
increasing number of consumers are starting to shop online. Quality data can give
marketers unique insights so that they can target highly personalized digital
marketing provide a great shopping experience. The global big data integration
software leader, released findings from its survey at the impact of the cloud on
data and application integration. The survey carried over 100 IT managers and
directors. The results detail current cloud usage and showcase the growing demand
for cloud based data storage, integration and analytics. An enterprise manages eight
SaaS applications on an average. Oracle, SAP, Salesforce and Dropbox are among
the most frequently SaaS apps in use. Cost is cited as the prohibiting factor by
companies that are yet to incorporate a good number of Saas applications.
However, there are a few companies who do not consider it to be a priority and
have integrated SaaS apps with others. Companies having cloud integration
platforms and integration Platform as a Service solutions, have big data on the top
of the priority list of additional capabilities. Big Data gives one the ability to collect,
manage and analyze large amounts of data, leading to changes in the way companies
deal with customers, resulting in increased profits and a competitive edge over other
companies. Big data is
Teenage Alcoholism
1.According to statistics on alcoholism and alcohol abuse statistics, even though
alcohol has been used in a number of diverse ways.
a.Throughout history these ways can be called useful, however, known thousands of
years ago that abusive and excessive drinking led to negative outcomes and adverse
alcohol side effects.
b.The symptoms associated with this are mostly societal and personal problems.
2.Research studies have shown that teenage alcoholism is correlated to the age at
which teens start drinking and to the amount and the frequency of their drinking.
3.More precisely, the average age when teenagers first try alcohol is 11 years old for
boys and 13 years old for girls.
a.The earlier teenagers drink, the more they ... Show more content on Helpwriting.net
...
teens who drink alcohol are 50 times more likely to use cocaine than teens who never
consume alcohol.
d.Research indicates that adolescents who use alcohol may remember 10 percent less
of what they have learned than those who don t drink.
e.In the U.S., problem drinkers are mostly found in young adults between the ages of
18 and 29
C.Statistics of alcohol and teens
1.Some studies done by NIAAA (National Institute on Alcohol Abuseand
Alcoholism) have shown the following:
a. Prevalence in 8th graders:
i. 51.7% have tried alcohol ii. 43.1% have had an alcoholic drink in the past year iii.
25.1% have been drunk iv. 15.2% have had 1 or more binge drinking episodes
2). Prevalence in 10th graders:
i. 70.6% have tried alcohol ii. 63.7% have had an alcoholic drink in the past year iii.
48.9% have been drunk iv. 25.6% have had 1 or more binge drinking episodes
v. 1.9% have been daily drinking for at least 1 month at some point in their lives
3). Prevalence in 12th graders:
i. 80% have tried alcohol ii. 73.8% have had an alcoholic drink in the past year iii.
62.3% have been drunk iv. 30.8% binge drank in the past 2 weeks
v. 3.6% use alcohol daily
2. In 2012, nearly three quarters of students (72 percent) have consumed alcohol a.
by the end of high school, and more than a third (37 percent) have done so by eighth
grade
3. From these statistics, you can see how widely abused alcohol really is.
Research Specific Risks, Threats, And Vulnerabilities On...
Research specific risks, threats, and vulnerabilities to Web and social networking
applications Social networking worms: Social networking worms include
Koobface, which has become, according to researchers, the largest Web 2.0 botnet.
While a multi faceted threat like Koobface challenges the definition of worm, it is
specifically designed to propagate across social networks (e.g., Facebook,
mySpace, Twitter, hi5, Friendster and Bebo), enlist more machines into its botnet,
and hijack more accounts to send more spam to enlist more machines. All the
while making money with the usual botnet business, including scareware and
Russian dating services. Trojans: Social networks have become a great vector for
Trojans click here and you get: Zeus a potent and popular banking Trojan that has
been given new life by social networks. There have been several recent high profile
thefts blamed on Zeus, notably the Duanesburg Central School district in New
York State late in 2009. Once a Zeus Trojan infects a machine, it remains dormant
until the end user visits a Web page with a form to fill out. One of the toolkit s
most powerful features is that it allows criminals to add fields to forms at the
browser level. This means that instead of directing the end user to a counterfeit
website, the user would see the legitimate website but might be asked to fill in an
additional blank with specific information for security reasons. URL Zone is a
similar banking Trojan, but even

Contenu connexe

Similaire à Argumentative Essay On Welfare

Short Essay On Money Laundering. Online assignment writing service.
Short Essay On Money Laundering. Online assignment writing service.Short Essay On Money Laundering. Online assignment writing service.
Short Essay On Money Laundering. Online assignment writing service.Brenda Gutierrez
 
One Page Business Proposal Sample PDF Template
One Page Business Proposal Sample PDF TemplateOne Page Business Proposal Sample PDF Template
One Page Business Proposal Sample PDF TemplateLorie Harris
 
Printable Dragon Writing Prompt Woo Jr. Kids Acti
Printable Dragon Writing Prompt  Woo Jr. Kids ActiPrintable Dragon Writing Prompt  Woo Jr. Kids Acti
Printable Dragon Writing Prompt Woo Jr. Kids ActiDenise Miller
 
Class Notes At Baruch College - OneClass
Class Notes At Baruch College - OneClassClass Notes At Baruch College - OneClass
Class Notes At Baruch College - OneClassJennifer Reither
 
Pay Someone To Write Your Research Paper. Write My Pape
Pay Someone To Write Your Research Paper. Write My PapePay Someone To Write Your Research Paper. Write My Pape
Pay Someone To Write Your Research Paper. Write My PapeChristina Bauer
 
Career Goals Essay Essay On Career Goals For Studen
Career Goals Essay Essay On Career Goals For StudenCareer Goals Essay Essay On Career Goals For Studen
Career Goals Essay Essay On Career Goals For StudenBrooke Heidt
 
Fordham University Essay Prompts
Fordham University Essay PromptsFordham University Essay Prompts
Fordham University Essay PromptsAnna May
 
How To Use Website Citations In An Essay
How To Use Website Citations In An EssayHow To Use Website Citations In An Essay
How To Use Website Citations In An EssayAngel Morris
 
Essay On Lost Purse. Online assignment writing service.
Essay On Lost Purse. Online assignment writing service.Essay On Lost Purse. Online assignment writing service.
Essay On Lost Purse. Online assignment writing service.Kara Flores
 
Ar 600-20 Chapter 4 Essay
Ar 600-20 Chapter 4 EssayAr 600-20 Chapter 4 Essay
Ar 600-20 Chapter 4 EssayKaty Shaw
 
Federalist Paper 10 Summary. The Federalist P
Federalist Paper 10 Summary. The Federalist PFederalist Paper 10 Summary. The Federalist P
Federalist Paper 10 Summary. The Federalist PVeronica Sulaiman
 
Perfect How To Write A Research Paper On Word
Perfect How To Write A Research Paper On WordPerfect How To Write A Research Paper On Word
Perfect How To Write A Research Paper On WordMelissa Kula
 

Similaire à Argumentative Essay On Welfare (13)

Short Essay On Money Laundering. Online assignment writing service.
Short Essay On Money Laundering. Online assignment writing service.Short Essay On Money Laundering. Online assignment writing service.
Short Essay On Money Laundering. Online assignment writing service.
 
One Page Business Proposal Sample PDF Template
One Page Business Proposal Sample PDF TemplateOne Page Business Proposal Sample PDF Template
One Page Business Proposal Sample PDF Template
 
Printable Dragon Writing Prompt Woo Jr. Kids Acti
Printable Dragon Writing Prompt  Woo Jr. Kids ActiPrintable Dragon Writing Prompt  Woo Jr. Kids Acti
Printable Dragon Writing Prompt Woo Jr. Kids Acti
 
Class Notes At Baruch College - OneClass
Class Notes At Baruch College - OneClassClass Notes At Baruch College - OneClass
Class Notes At Baruch College - OneClass
 
Pay Someone To Write Your Research Paper. Write My Pape
Pay Someone To Write Your Research Paper. Write My PapePay Someone To Write Your Research Paper. Write My Pape
Pay Someone To Write Your Research Paper. Write My Pape
 
Career Goals Essay Essay On Career Goals For Studen
Career Goals Essay Essay On Career Goals For StudenCareer Goals Essay Essay On Career Goals For Studen
Career Goals Essay Essay On Career Goals For Studen
 
Fordham University Essay Prompts
Fordham University Essay PromptsFordham University Essay Prompts
Fordham University Essay Prompts
 
How To Use Website Citations In An Essay
How To Use Website Citations In An EssayHow To Use Website Citations In An Essay
How To Use Website Citations In An Essay
 
Essay On Lost Purse. Online assignment writing service.
Essay On Lost Purse. Online assignment writing service.Essay On Lost Purse. Online assignment writing service.
Essay On Lost Purse. Online assignment writing service.
 
Essay Q Significa
Essay Q SignificaEssay Q Significa
Essay Q Significa
 
Ar 600-20 Chapter 4 Essay
Ar 600-20 Chapter 4 EssayAr 600-20 Chapter 4 Essay
Ar 600-20 Chapter 4 Essay
 
Federalist Paper 10 Summary. The Federalist P
Federalist Paper 10 Summary. The Federalist PFederalist Paper 10 Summary. The Federalist P
Federalist Paper 10 Summary. The Federalist P
 
Perfect How To Write A Research Paper On Word
Perfect How To Write A Research Paper On WordPerfect How To Write A Research Paper On Word
Perfect How To Write A Research Paper On Word
 

Plus de Karen Goldmas

Essay On Pakistan Our Motherland.pdfEssay On Pakistan Our Motherland
Essay On Pakistan Our Motherland.pdfEssay On Pakistan Our MotherlandEssay On Pakistan Our Motherland.pdfEssay On Pakistan Our Motherland
Essay On Pakistan Our Motherland.pdfEssay On Pakistan Our MotherlandKaren Goldmas
 
New Ssat Essay Prompts
New Ssat Essay PromptsNew Ssat Essay Prompts
New Ssat Essay PromptsKaren Goldmas
 
How I Spent My Summer Vacation Essay For Class 6Th
How I Spent My Summer Vacation Essay For Class 6ThHow I Spent My Summer Vacation Essay For Class 6Th
How I Spent My Summer Vacation Essay For Class 6ThKaren Goldmas
 
Essay On My Country In English For Class 5
Essay On My Country In English For Class 5Essay On My Country In English For Class 5
Essay On My Country In English For Class 5Karen Goldmas
 
Essay On Family History
Essay On Family HistoryEssay On Family History
Essay On Family HistoryKaren Goldmas
 
Computer Literacy Essay
Computer Literacy EssayComputer Literacy Essay
Computer Literacy EssayKaren Goldmas
 
Practice Sat Essay Prompt
Practice Sat Essay PromptPractice Sat Essay Prompt
Practice Sat Essay PromptKaren Goldmas
 
Shawshank Redemption Essay Hope
Shawshank Redemption Essay HopeShawshank Redemption Essay Hope
Shawshank Redemption Essay HopeKaren Goldmas
 
Fahrenheit 451 Essay Questions
Fahrenheit 451 Essay QuestionsFahrenheit 451 Essay Questions
Fahrenheit 451 Essay QuestionsKaren Goldmas
 
Essay Written In Apa Format
Essay Written In Apa FormatEssay Written In Apa Format
Essay Written In Apa FormatKaren Goldmas
 
Into The Wild Essay Topics
Into The Wild Essay TopicsInto The Wild Essay Topics
Into The Wild Essay TopicsKaren Goldmas
 
The Color Purple Essay Questions
The Color Purple Essay QuestionsThe Color Purple Essay Questions
The Color Purple Essay QuestionsKaren Goldmas
 
Essay About The Mother
Essay About The MotherEssay About The Mother
Essay About The MotherKaren Goldmas
 
Poetry Analysis Essay Sample
Poetry Analysis Essay SamplePoetry Analysis Essay Sample
Poetry Analysis Essay SampleKaren Goldmas
 
Waiting For Superman Essay
Waiting For Superman EssayWaiting For Superman Essay
Waiting For Superman EssayKaren Goldmas
 
Salem Witch Trial Essay
Salem Witch Trial EssaySalem Witch Trial Essay
Salem Witch Trial EssayKaren Goldmas
 

Plus de Karen Goldmas (20)

Essay On Pakistan Our Motherland.pdfEssay On Pakistan Our Motherland
Essay On Pakistan Our Motherland.pdfEssay On Pakistan Our MotherlandEssay On Pakistan Our Motherland.pdfEssay On Pakistan Our Motherland
Essay On Pakistan Our Motherland.pdfEssay On Pakistan Our Motherland
 
New Ssat Essay Prompts
New Ssat Essay PromptsNew Ssat Essay Prompts
New Ssat Essay Prompts
 
How I Spent My Summer Vacation Essay For Class 6Th
How I Spent My Summer Vacation Essay For Class 6ThHow I Spent My Summer Vacation Essay For Class 6Th
How I Spent My Summer Vacation Essay For Class 6Th
 
Essay On Ncc Camp
Essay On Ncc CampEssay On Ncc Camp
Essay On Ncc Camp
 
Essay On My Country In English For Class 5
Essay On My Country In English For Class 5Essay On My Country In English For Class 5
Essay On My Country In English For Class 5
 
Essay On Family History
Essay On Family HistoryEssay On Family History
Essay On Family History
 
Computer Literacy Essay
Computer Literacy EssayComputer Literacy Essay
Computer Literacy Essay
 
Practice Sat Essay Prompt
Practice Sat Essay PromptPractice Sat Essay Prompt
Practice Sat Essay Prompt
 
Persuation Essay
Persuation EssayPersuation Essay
Persuation Essay
 
Essay On Leadership
Essay On LeadershipEssay On Leadership
Essay On Leadership
 
Shawshank Redemption Essay Hope
Shawshank Redemption Essay HopeShawshank Redemption Essay Hope
Shawshank Redemption Essay Hope
 
Fahrenheit 451 Essay Questions
Fahrenheit 451 Essay QuestionsFahrenheit 451 Essay Questions
Fahrenheit 451 Essay Questions
 
Essay Written In Apa Format
Essay Written In Apa FormatEssay Written In Apa Format
Essay Written In Apa Format
 
Passive Essay
Passive EssayPassive Essay
Passive Essay
 
Into The Wild Essay Topics
Into The Wild Essay TopicsInto The Wild Essay Topics
Into The Wild Essay Topics
 
The Color Purple Essay Questions
The Color Purple Essay QuestionsThe Color Purple Essay Questions
The Color Purple Essay Questions
 
Essay About The Mother
Essay About The MotherEssay About The Mother
Essay About The Mother
 
Poetry Analysis Essay Sample
Poetry Analysis Essay SamplePoetry Analysis Essay Sample
Poetry Analysis Essay Sample
 
Waiting For Superman Essay
Waiting For Superman EssayWaiting For Superman Essay
Waiting For Superman Essay
 
Salem Witch Trial Essay
Salem Witch Trial EssaySalem Witch Trial Essay
Salem Witch Trial Essay
 

Dernier

Paris 2024 Olympic Geographies - an activity
Paris 2024 Olympic Geographies - an activityParis 2024 Olympic Geographies - an activity
Paris 2024 Olympic Geographies - an activityGeoBlogs
 
internship ppt on smartinternz platform as salesforce developer
internship ppt on smartinternz platform as salesforce developerinternship ppt on smartinternz platform as salesforce developer
internship ppt on smartinternz platform as salesforce developerunnathinaik
 
Blooming Together_ Growing a Community Garden Worksheet.docx
Blooming Together_ Growing a Community Garden Worksheet.docxBlooming Together_ Growing a Community Garden Worksheet.docx
Blooming Together_ Growing a Community Garden Worksheet.docxUnboundStockton
 
_Math 4-Q4 Week 5.pptx Steps in Collecting Data
_Math 4-Q4 Week 5.pptx Steps in Collecting Data_Math 4-Q4 Week 5.pptx Steps in Collecting Data
_Math 4-Q4 Week 5.pptx Steps in Collecting DataJhengPantaleon
 
The Most Excellent Way | 1 Corinthians 13
The Most Excellent Way | 1 Corinthians 13The Most Excellent Way | 1 Corinthians 13
The Most Excellent Way | 1 Corinthians 13Steve Thomason
 
Final demo Grade 9 for demo Plan dessert.pptx
Final demo Grade 9 for demo Plan dessert.pptxFinal demo Grade 9 for demo Plan dessert.pptx
Final demo Grade 9 for demo Plan dessert.pptxAvyJaneVismanos
 
POINT- BIOCHEMISTRY SEM 2 ENZYMES UNIT 5.pptx
POINT- BIOCHEMISTRY SEM 2 ENZYMES UNIT 5.pptxPOINT- BIOCHEMISTRY SEM 2 ENZYMES UNIT 5.pptx
POINT- BIOCHEMISTRY SEM 2 ENZYMES UNIT 5.pptxSayali Powar
 
How to Make a Pirate ship Primary Education.pptx
How to Make a Pirate ship Primary Education.pptxHow to Make a Pirate ship Primary Education.pptx
How to Make a Pirate ship Primary Education.pptxmanuelaromero2013
 
Introduction to AI in Higher Education_draft.pptx
Introduction to AI in Higher Education_draft.pptxIntroduction to AI in Higher Education_draft.pptx
Introduction to AI in Higher Education_draft.pptxpboyjonauth
 
ENGLISH5 QUARTER4 MODULE1 WEEK1-3 How Visual and Multimedia Elements.pptx
ENGLISH5 QUARTER4 MODULE1 WEEK1-3 How Visual and Multimedia Elements.pptxENGLISH5 QUARTER4 MODULE1 WEEK1-3 How Visual and Multimedia Elements.pptx
ENGLISH5 QUARTER4 MODULE1 WEEK1-3 How Visual and Multimedia Elements.pptxAnaBeatriceAblay2
 
Enzyme, Pharmaceutical Aids, Miscellaneous Last Part of Chapter no 5th.pdf
Enzyme, Pharmaceutical Aids, Miscellaneous Last Part of Chapter no 5th.pdfEnzyme, Pharmaceutical Aids, Miscellaneous Last Part of Chapter no 5th.pdf
Enzyme, Pharmaceutical Aids, Miscellaneous Last Part of Chapter no 5th.pdfSumit Tiwari
 
Science lesson Moon for 4th quarter lesson
Science lesson Moon for 4th quarter lessonScience lesson Moon for 4th quarter lesson
Science lesson Moon for 4th quarter lessonJericReyAuditor
 
Presiding Officer Training module 2024 lok sabha elections
Presiding Officer Training module 2024 lok sabha electionsPresiding Officer Training module 2024 lok sabha elections
Presiding Officer Training module 2024 lok sabha electionsanshu789521
 
ECONOMIC CONTEXT - LONG FORM TV DRAMA - PPT
ECONOMIC CONTEXT - LONG FORM TV DRAMA - PPTECONOMIC CONTEXT - LONG FORM TV DRAMA - PPT
ECONOMIC CONTEXT - LONG FORM TV DRAMA - PPTiammrhaywood
 
A Critique of the Proposed National Education Policy Reform
A Critique of the Proposed National Education Policy ReformA Critique of the Proposed National Education Policy Reform
A Critique of the Proposed National Education Policy ReformChameera Dedduwage
 
Crayon Activity Handout For the Crayon A
Crayon Activity Handout For the Crayon ACrayon Activity Handout For the Crayon A
Crayon Activity Handout For the Crayon AUnboundStockton
 
Employee wellbeing at the workplace.pptx
Employee wellbeing at the workplace.pptxEmployee wellbeing at the workplace.pptx
Employee wellbeing at the workplace.pptxNirmalaLoungPoorunde1
 
Introduction to ArtificiaI Intelligence in Higher Education
Introduction to ArtificiaI Intelligence in Higher EducationIntroduction to ArtificiaI Intelligence in Higher Education
Introduction to ArtificiaI Intelligence in Higher Educationpboyjonauth
 

Dernier (20)

Model Call Girl in Tilak Nagar Delhi reach out to us at 🔝9953056974🔝
Model Call Girl in Tilak Nagar Delhi reach out to us at 🔝9953056974🔝Model Call Girl in Tilak Nagar Delhi reach out to us at 🔝9953056974🔝
Model Call Girl in Tilak Nagar Delhi reach out to us at 🔝9953056974🔝
 
Paris 2024 Olympic Geographies - an activity
Paris 2024 Olympic Geographies - an activityParis 2024 Olympic Geographies - an activity
Paris 2024 Olympic Geographies - an activity
 
internship ppt on smartinternz platform as salesforce developer
internship ppt on smartinternz platform as salesforce developerinternship ppt on smartinternz platform as salesforce developer
internship ppt on smartinternz platform as salesforce developer
 
Blooming Together_ Growing a Community Garden Worksheet.docx
Blooming Together_ Growing a Community Garden Worksheet.docxBlooming Together_ Growing a Community Garden Worksheet.docx
Blooming Together_ Growing a Community Garden Worksheet.docx
 
_Math 4-Q4 Week 5.pptx Steps in Collecting Data
_Math 4-Q4 Week 5.pptx Steps in Collecting Data_Math 4-Q4 Week 5.pptx Steps in Collecting Data
_Math 4-Q4 Week 5.pptx Steps in Collecting Data
 
The Most Excellent Way | 1 Corinthians 13
The Most Excellent Way | 1 Corinthians 13The Most Excellent Way | 1 Corinthians 13
The Most Excellent Way | 1 Corinthians 13
 
Final demo Grade 9 for demo Plan dessert.pptx
Final demo Grade 9 for demo Plan dessert.pptxFinal demo Grade 9 for demo Plan dessert.pptx
Final demo Grade 9 for demo Plan dessert.pptx
 
TataKelola dan KamSiber Kecerdasan Buatan v022.pdf
TataKelola dan KamSiber Kecerdasan Buatan v022.pdfTataKelola dan KamSiber Kecerdasan Buatan v022.pdf
TataKelola dan KamSiber Kecerdasan Buatan v022.pdf
 
POINT- BIOCHEMISTRY SEM 2 ENZYMES UNIT 5.pptx
POINT- BIOCHEMISTRY SEM 2 ENZYMES UNIT 5.pptxPOINT- BIOCHEMISTRY SEM 2 ENZYMES UNIT 5.pptx
POINT- BIOCHEMISTRY SEM 2 ENZYMES UNIT 5.pptx
 
How to Make a Pirate ship Primary Education.pptx
How to Make a Pirate ship Primary Education.pptxHow to Make a Pirate ship Primary Education.pptx
How to Make a Pirate ship Primary Education.pptx
 
Introduction to AI in Higher Education_draft.pptx
Introduction to AI in Higher Education_draft.pptxIntroduction to AI in Higher Education_draft.pptx
Introduction to AI in Higher Education_draft.pptx
 
ENGLISH5 QUARTER4 MODULE1 WEEK1-3 How Visual and Multimedia Elements.pptx
ENGLISH5 QUARTER4 MODULE1 WEEK1-3 How Visual and Multimedia Elements.pptxENGLISH5 QUARTER4 MODULE1 WEEK1-3 How Visual and Multimedia Elements.pptx
ENGLISH5 QUARTER4 MODULE1 WEEK1-3 How Visual and Multimedia Elements.pptx
 
Enzyme, Pharmaceutical Aids, Miscellaneous Last Part of Chapter no 5th.pdf
Enzyme, Pharmaceutical Aids, Miscellaneous Last Part of Chapter no 5th.pdfEnzyme, Pharmaceutical Aids, Miscellaneous Last Part of Chapter no 5th.pdf
Enzyme, Pharmaceutical Aids, Miscellaneous Last Part of Chapter no 5th.pdf
 
Science lesson Moon for 4th quarter lesson
Science lesson Moon for 4th quarter lessonScience lesson Moon for 4th quarter lesson
Science lesson Moon for 4th quarter lesson
 
Presiding Officer Training module 2024 lok sabha elections
Presiding Officer Training module 2024 lok sabha electionsPresiding Officer Training module 2024 lok sabha elections
Presiding Officer Training module 2024 lok sabha elections
 
ECONOMIC CONTEXT - LONG FORM TV DRAMA - PPT
ECONOMIC CONTEXT - LONG FORM TV DRAMA - PPTECONOMIC CONTEXT - LONG FORM TV DRAMA - PPT
ECONOMIC CONTEXT - LONG FORM TV DRAMA - PPT
 
A Critique of the Proposed National Education Policy Reform
A Critique of the Proposed National Education Policy ReformA Critique of the Proposed National Education Policy Reform
A Critique of the Proposed National Education Policy Reform
 
Crayon Activity Handout For the Crayon A
Crayon Activity Handout For the Crayon ACrayon Activity Handout For the Crayon A
Crayon Activity Handout For the Crayon A
 
Employee wellbeing at the workplace.pptx
Employee wellbeing at the workplace.pptxEmployee wellbeing at the workplace.pptx
Employee wellbeing at the workplace.pptx
 
Introduction to ArtificiaI Intelligence in Higher Education
Introduction to ArtificiaI Intelligence in Higher EducationIntroduction to ArtificiaI Intelligence in Higher Education
Introduction to ArtificiaI Intelligence in Higher Education
 

Argumentative Essay On Welfare

  • 1. Argumentative Essay On Welfare Writing an argumentative essay on the topic of welfare can be a challenging task that requires careful consideration of various perspectives and a thorough understanding of the subject matter. The topic itself is multifaceted, involving complex issues related to social, economic, and political aspects. Crafting a well-reasoned argument requires extensive research to gather relevant information and data to support your claims. One of the difficulties lies in navigating the sensitive nature of the welfare system. The topic often involves discussions on poverty, inequality, government policies, and societal responsibilities. Addressing these issues requires a nuanced approach to ensure that your arguments are well-grounded, respectful, and considerate of diverse viewpoints. Furthermore, constructing a coherent and persuasive thesis statement is essential in an argumentative essay. It should clearly articulate your stance on the topic while setting the stage for the subsequent development of your arguments. Formulating strong arguments and counterarguments, supported by credible evidence, demands critical thinking and analytical skills. In addition, maintaining a logical flow throughout the essay is crucial. Transitioning seamlessly between different points and sections while maintaining clarity and coherence can be a challenge. Striking the right balance between presenting facts and incorporating your own analysis is another aspect that requires careful attention. Despite the challenges, writing an argumentative essay on the welfare topic can be a rewarding experience. It allows you to engage with important societal issues, develop your analytical skills, and enhance your ability to articulate and defend your opinions. For those seeking assistance with essays on various topics, including argumentative essays on welfare, there are resources available. Websites likeHelpWriting.net offer services where you can order custom essays tailored to your specific requirements. These services can provide support in structuring your essay, conducting research, and ensuring that your arguments are well-developed. Keep in mind that while seeking assistance can be helpful, it's important to maintain academic integrity and ensure that the work aligns with your own understanding and perspective on the topic. Argumentative Essay On WelfareArgumentative Essay On Welfare
  • 2. The Importance Of Investment In A Website Why is investing in a website a good step for your business? Here are great reasons why you need to have a website. The investment you make in your website is a sustainable investment (your site exists as long as you renew the hosting and the domain name), especially if you opt for a solution that offers an easy to use interface and allows to evolve your site at the same timeas your activity. In our connected world, many shopping decisions are made at a computer screen. Imagine those customers you may have lost because you don t have a website. A web page can then become a very important source of information about everything that affects your products and services for your customers. People from all over can find your website and ... Show more content on Helpwriting.net ... Today, it s also easy to use a website to advertise and increase your visibility. Also, by setting up the right tools (payment buttons, forms, automated procedures, etc.) you can get prospects and customers at any time of the day and even during the holidays. It is also an element that will bring you more credibility. Your website is an investment and not an expense. In the short and medium term, you will see the benefits of a website. And your website can also help you defeat your rivals. An about page allows you to tell your readers who you are, the goal of your website and the experience you have. This is a very important page that can help you quickly win credibility in the eyes of a surfer who arrives on your website for the first time. Is there any affiliate program that you would like to promote? For example, a customer s garden is in great need of landscaping and they have a lot of flyers of landscaping companies. Therefore, the first reflex may be to check the information that they found on the internet about these landscaping companies. Imagine your customer who bought 5 years ago at home, do you think he would like new information? Your clientele is no longer limited to people in your city or region. Your site is the center of your online presence. Your website is your anchor, your home on the internet. A website
  • 3. Bank LESSON 14: CASH BOOK, PASS BOOK, BANK RECONCILIATION STATEMENT Dr. Jyotsna Sethi, Rekha Rani STRUCTURE 14.1 Introduction 14.2 Objectives 14.3 Cash Book 14.4 Types of Cash Book 14.4.1 Simple Cash Book 14.4.2 Two Column Cash Book 14.4.3 Three Column Cash Book 14.5 Petty Cash Book. 14.5.1. Imprest System of Petty Cash Book. 14.5.2 Advantages of Petty Cash Book 14.6 Pass Book 14.7. Bank Reconciliation Statement 14.7.1 Meaning 14.7.2. Causes for difference between Cash Book Balance and Pass Book Balance. 14.7.3. Need and importance of Bank Reconciliation Statement 14.7.4 Procedure for preparation of Bank Reconciliation Statement. 14.8. 14.9. Summary Glossary 14.10. Self Assessment Questions 14.11. Answer to check your progress 14.12.... Show more content on Helpwriting.net ... Dec 2 Dec 3 Dec 4 Dec 5 Dec 6 Cash in Hand Received from Ramesh Purchased Furniture Machinery Sold Goods sold Salaries paid Rs. 10,000 13,000 15,000 10,000 20,000 1,000 ............................................................................................. ............................................................................................. ............................................................................................. ............................................................................................. ............................................................................................. 14.4.2. TWO COLUMN CASH BOOK A two column cash back records discount allowed and discount received along with the cash payments and cash receipts. Discount allowed is the concession given by the businessman to its customers or debtors e.g. if a debtor has to pay Rs. 10,000 and he is allowed 10% discount, now he will pay only Rs. 9000 to the firm. This is called discount allowed, it is a type of loss for the business so it is to be debited and recorded in Dr. Side of the cash book. Discount received is the concession received by the business man from the creditors. e.g. if a firm has to pay Rs. 50,000 to its creditors and discount received is 20% then the firm has to pay only Rs. 40,000 to the creditor. This is called discount received, it is a gain or profit for the firm so it is to be credited and recorded in the Cr. side of the cash book the specimen Performa of a two column cash Book is given as under Two column Cash Book Dr Date Receipts Particulars Amount Dis. Amount Cash Date Payments Particular Amt. Dis. Cr Amt. Cash 213 Note: Discount columns are not balanced they are merely totaled. Example 2: Enter the following
  • 4. The Correlation Between Sex Tourism And Prostitution Tourism has been a major contributor to the economic, social and human development of Morocco. Its social and economic impacts such as the reduction of unemployment and poverty are clearly evident in today s society. With a growth of 6.0% in its tourism compared to the world average growth rate of 1.6%, the success of the Moroccan tourism sector is without any doubts astonishing. In fact, tourism has become one of the most important sectors for Morocco. It is said that the reasons behind this success are mainly due to the development and implementation of new policies under the reign of the monarch, King Mohammed IV, and the development of certain industries such as agriculture and textile. In this paper, however, I argue that there are other factors behind Morocco s rapid development in the tourism industry that are ignored due to social and religious reasons. In order to demonstrate this point, I will examine the predominance of sex tourism and prostitution in Morocco and how they play a major role in the development and success of tourism. Finally, I contend that the tourism sector is not sustainable as its social and economic impacts have already started affecting negatively the social life of the Moroccan population. Unless an alternative of sustainable tourism is put in place, this growth in the tourism industry will disappear leading to unprecedented and unwanted consequences. Before examining the sex tourism in Morocco, let us first look at its starting point. The
  • 5. Empathy Star Trek Star Trek: TNG and the Cultivation of Empathy In this paper, I argue that watching Star Trek: The Next Generation cultivates empathy. Empathy is a good that human beings ought to develop and having a sense of empathy is one of the best things in life. Empathy consists in the capacity to understand what another person is going through from their perspective. The reason that a sense of empathy is one of the best things in life is that it is impossible to have deep and meaningful relationships with others when we don t have empathy. Without empathy, we inevitably turn inward and live a lonely life. For this reason, empathy is one of the best things in life. Regular watching of Star Trek: TNG increases our capacity for empathy. The reason why this is the case is that watching acts ... Show more content on Helpwriting.net ... Now characters in Star Trek: TNG routinely show empathetic concern for one another. For instance, when a race of cyborgs capture Jean Luc Picard (captain of the Enterprise on the show), the crew of the Enterprise do everything in their power to rescue Picard. One of their main motivations for rescuing Picard is their experience of the sense of distress that he experiences while in captivity. This is just one instance where empathy is shown in the program, but it happens on a regular basis. In sum, watching Star Trek: TNG increases our capacity for empathy because the characters regularly display empathy on the show and because we tend to imitate the actions that we see other human beings performing. Someone might object to this argument by pointing out that characters on the show also display cruelty that involves a lack of empathy. For instance, in one episode a malevolent being kills one of the members for the crew for no apparent reason. If we watch this cruelty, then perhaps we ourselves might behave more cruelly. But this objection can be refuted. Cruelty on the show is always shown in
  • 6. Reflective Essay On Leadership Leadership is such a simple term for such a complex phenomenon. As a child, I can remember adult phrases like natural born leader that contributed to my naГЇve notion of how leaders are preordained at birth with the gifts or qualities necessary for leadership, or at the very least nurtured by parents who were natural leaders. As a result, I never truly felt natural when called into leadershippositions throughout my life. As a teenager, I was confused when both adults and peers called me to be their leader. At sixteen, I finally felt confident enough to try out for cheerleading. Not only was I given a position on the basketball cheer squad both my junior and senior year of high school, but I was also voted to be team captain unanimously both years. But why? What did they see which I did not? A similar curious posture came when a member of Forbes UMC s, my home church, nomination committee approached me about becoming an education committee member at age seventeen. But why? Again and again I was called up to lead in my small social contexts. College was no different as my second year of cheerleading found our squad in need of a new captain as the senior captain stepped down from leadership for academic reasons. Again, it was a unanimous vote. But why? I stress the unanimous verdicts not to boast, but to highlight a reflection I had not considered until now. Every time I asked But why? to my leaders and coaches they all answered in a similar way. My dedication to the cause
  • 7. Russia in World War One Essay Russia in World War One Against a domestic background of widespread strikes and violent government assaults on strikers, Russia entered WWI in August, 1914. with the world s largest army. Poorly trained and equipped, they quickly went from early success to catastrophic defeat. The disastrous fortunes of the Russian army undermined the authority of the government. There were conscription (draft) riots in the cities. There were food shortages. Russialost territory. People who did not oppose the war because of political sentiments opposed it because they saw it as a disaster for the Russian people. By the end of 1916, the Russians had lost more than a million men and continued to lose major... Show more content on Helpwriting.net ... The Bolsheviks agreed to help but made it clear they were fighting against Kornilov s troops and not in support of the government. In just a few days, they raised an armed militia of 25,000 and fortified the city. Kornilov s soldiers refused to try to take Petrograd by force. Kornilov was arrested, his general commited suicide, and Kerensky had a new problem on his hands. The Bolsheviks now had control of the Soviets and the Red Guard, control of Petrograd, and a small but well organized and armed militia. The Mensheviks had allied themselves with Kerensky, Kerensky had tried to broker a deal with the landowners, and had sent the Cossacks out to subdue the revolutionaries in the countryside. None of this was well received by the workers. At the urging of Trotsky, the Red Guards stormed the Winter Palace, Kerensky ran to France, and the Bolsheviks were now in control. But wasn t Trotsky on the side of the Mensheviks? He had been, but he was one of many who were greatly angered by the Mensheviks support of Kerensky. He was by now a pacifist as far as the war was concerned, a believer in permanent revolution, and totally opposed to Kerensky s alliances with the propertied classes. So he joined with the Bolsheviks when he returned to Russia from his long and turbulent exile abroad. He was instrumental in
  • 8. Alexander Gideon Lightwood Research Paper Esther Yang Archery 9:00 9:50 AM Alec Lightwood Alexander Gideon Lightwood or as he calls himself, Alec, is a kick butt, sexy looking Shadowhunter from the book series The Mortal Instruments. He was born in Idris in September 1989 and the eldest child of Robert and Maryse Lightwood. His siblings are Isabelle Sophia, Max Joseph (Rest his soul), and his adopted brother Jace Lightwood Herondale. Soon after he was born, he and his family were exiled from Idris, because his parents had joined with a rebel group called, The Circle of Raziel. An occult like group whose purpose was to purify the world of demons, magical creatures, and all species of Downlorders for the human kind. His family now runs the New York Institute for the Shadowhunter council as their punishment and where he and his siblings grew up together. Shadowhunters or also known as Nephilim have existed since the rise of human kind. They are a secret race of humans born with angelic blood. Specifically, the Angel Raziel s blood that he poured into a chalice called the Mortal Cup for his chosen followers to drink from to gain powers to fight demons and the other dark creatures. This race of humans are stronger, smarter, faster, and have the ability to see past the veil that hides the Downlorder world from the human world through the use of... Show more content on Helpwriting.net ... For instance, His sister, Isabelle s choice of weapon is an electrum laced whip and his brother Jace prefers to use swords. Alec s preferred choice of weapon is the bow and arrow. He is the only one in his family who has chosen the bow and arrow as his choice in weaponry. A majority of Shadowhunters use close quarter weapons to decapitate and kill their opponents, so it is rare that a Shadowhunter would choose a long range weapon as a
  • 9. Pieta Michelangelo On March 6, Michelangelo was brought into this world by his mother, Francesca di Neri del Miniato di Siena, and his father, Ludovico di Leonardo Buonarroti Simoni, in Caprese, Italy in 1475. His mother pasted away in 1481, when he was just six years old; during that time, he was placed with a family of stonecutters. Later on Michelangelos father realized that his son had no interest in the family business, therefore, at the age of 13, he engaged to the Florentine painter s workshop. There he was introduced to the painter Domenico Ghirlandaio, and he was exposed to the technique of fresco. When Michelangelo was 21 years old, he arrived in Rome on June 25, 1496. On the fourth of July of that same year, he began to work on the over life size... Show more content on Helpwriting.net ... It was known as one of the world s great masterpieces of sculpture, and it was finished when he was 24 years old. Michelangelo s Pieta is now displayed at the Vatican City, in St. Peter s Basilica after being moved over 5 times while it is six feet wide and nearly as tall. He returned to Florence in 1499. He took over the statue of David, which two sculptors had previously attempted, but left him unfinished. Michelangelo responded by completing his most famous work in 1504. David stands 17 feet tall and it stands on an 8 foot pedestal. In 1505, he Michelangelo was invited to come back to Rome by the Pope Julius II. He was given the job to build the Pope s tomb, which was to include 40 statues and be finished in a total of 5 years. Although he worked on it for 40 years, it was never truly finished to his satisfaction. During that same time period, in 1508, Michelangelo painted the ceiling of the Sistine Chapel. It took him approximately 4 years to complete. The composition stretches over 500 square meters of ceiling and contains over 300 figures. He revealed the finished work on October 31,
  • 10. A Comparison Of The Glass Menagerie While reading Tennessee Williams play, The Glass Menagerie , readers are drawn into the drama and disaster that is the Wingfield family. There were several different film and television versions of this play done thru the years from 1950 to 1987. After watching several different adaptations, Paul Newman s film adaptation in 1987 is extremely faithful to the written version. Focusing on plot, setting, and character development the audienceis introduced to a familywith an austere future structured around a series of abandonments, difficulty accepting reality and the impossibility of true escape. Both versions begin with a narrator looking back at the past and setting the stage for what memories will follow. The story is told in hindsight by Tom. It begins with Laura and Amanda waiting at the dining table for Tom to join them, so they can say grace and begin the meal, showing the audience, the family is very close and depend on each other. Throughout, readers also see constant conflict between the mother and children, but never conflict between the siblings. For instance, when Williams writes after an argument between Tom and Amanda; AMANDA: I won t speak to you until you apologize! (25) then the next morning Amanda sending Laura out, so she can talk to Tom privately to discuss Laura s future. Trying to provide security to Laura and Amanda (at Amanda s request), Tom invites and friend, Jim, home from work to meet his sister in the hopes that he will assume the
  • 11. Guided Meditation Practices In guided meditation, guided imagery or guided relaxation techniques, the instructor offers suggestions to guide the listener into a meditative state. Visualization practices can be similarly guided, or practiced on one s own. The goal of these techniques can be relaxation, healing, uplifting emotions, inner peace or other desired outcomes. The Transcendental Meditation technique is not guided meditation and does not depend on a CD or any outside guide. It is not a process of bringing awareness to the body or imagining a peaceful, relaxed state or particular goal in life. Although guided meditation practices may create pleasant moods or degrees of relaxation, much greater benefit comes from the process of transcending the realm of thinking ... Show more content on Helpwriting.net ... Guided meditation and visualization In guided meditation practices also called guided imagery or guided relaxation a speaker offers instruction or suggestion to guide the listener into a meditative state. Visualization practices can be similarly guided, or practiced on one s own. The aim can be relaxation, positive thinking, healing, inner peace or other desired outcomes. Guided meditation and visualization tend to keep attention in the active realm of thinking, imagining and feeling. The TM technique is not guided meditation and does not require a CD or any outside influence. It is not an act of merely imagining a peaceful, settled state, and its positive affect on daily life is more far reaching. The TM technique is not guided meditation and does not require a CD or any outside influence. It is not an act of merely imagining a peaceful, settled state, and its positive affect on daily life is more far
  • 12. The Spanish And Mexican Period 1. The story line I am going to talk about is power and oppression, throughout California s history there has been many events of power and oppression that has shaped California s history in many ways. I selected this storyline because I am able to relate many of these events that have happened throughout history. I will described the Spanish and Mexican period, the Americanization period, the early 20th century, and the late 20th century to today. First I will begin with the Spanish and Mexican period 1776 1846, during these period we could see that there was a lot of power and oppression that started with the Spanish conquest to expand their colonization. The spanish brought with them christianity trying to convert Native Americans to become that same religion, the spanish developed a series of presidios, missions, and pueblos in the lands of Native Americans where they were forced to change their religion, customs, and culture to become part of the Spanish. Many Native Americans were killed by the Spanish soldiers when they would decline to change their way of living. The Spanish practice oppression trying to convert this people into christianity this is an example of the power and oppression the spanish used during these period of time. After Mexico became independent from the Spanish empire the Mexican government took control of California and during these period, the Mexican government put an end to the mission/presidio system. The Mexican government allowed
  • 13. The Importance Of The Conformity Of Uniforms I researched how the conformity of uniforms in schools have violated a number of First Amendment rights. The First Amendment of the United States was ratified, on December 15, 1791. It promises protection for all to express their individual freedoms of religion, speech, press, the right of assembly, and the right of petition. These terms back in 1791 were not distinguished. Even now in the 21st Century the words remain subjective to ongoing interpretation and debate. The placement of uniforms in schools can discriminate against gender equality, as well as one s sexual orientation, political views, and religion. The First Amendment was put in place to grant these individual freedoms, yet students are expected to conform to school policies regardless of their own beliefs. An example of this violation would be Tinker v. Des Moines. In this court case students from a school in Des Moines, Iowa were threatened with suspension if they went through with a plan to silently protest the war in Vietnam. The students involved were denied their right to peacefully assemble. It is stated in the First Amendment that Congress shall make no law respecting an establishment of religion, or prohibiting the free exercise thereof; or abridging the freedom of speech, or of the press; or the right of the people peaceably to assemble, and to petition the Government for a redress of grievances. The children who were suspended for proceeding with the plan of peaceful protest sued the school district through their parents for a violation of their First Amendment rights. In the District Court the judge ruled in favor of the school district, claiming the school s actions were fair to maintain school discipline. Their ruling, however was reversed in the Supreme Court when it was asked if the prohibition of a form of symbolic protest, violated the students freedom of speech guaranteed by the First Amendment? I will be using this court case to address current issues that also violate or at least put a restriction on a student s First Amendment rights in schools. The definition of conformity is the compliance or acquiescence of obedience. Conformity is encouraged with a high level of visual similarity among members of
  • 14. Correlation Between The Data, And The Fitted Values Essay Abstract We use diagnostic method to find residual and influence in nonlinear regression for repeated measurement data. The purpose of that to detect disparity between the data, and the fitted values as well as disparity among a few data sets. Most of these Techniques based on graphical representation of residuals, hat matrix and case deletion measures. After fitting a regression model, it is important to regulate whether the entire requisite models supposition are reasonable before performing inference. If there are any breaches, subsequent inferential procedures may be invalid resulting in faulty conclusions. Therefore, it is crucial to perform appropriate model diagnostic. The one step approximation the estimates, generalized cook distance and likelihood distance are considered. Cook and likelihood distance are two statistical diagnostics method. Models diagnostics procedures imply both graphical and formal statistical tests. These procedures recognize us to inspect whether the supposition of the regression model are justifiable and decide whether we can belief subsequent inference outcome. We use these methods to explore the performance of residual and influence in nonlinear regression model. These residuals can produce confusing results when used in diagnostic method corresponding to those for linear regression. Simulation provide to
  • 15. The Importance Of Organizational Intentions Among The... The organizational expressions differ among the Spokane, Portland, Houston, and Madison Police Departments because every police department focuses on their purpose of organization, defines what is important to that specific police department,and community, and establishes organizational goals to align with their practices and values (Cordner 2016, p. 48). These organizational expressions also differ among the departments based upon community needs and departmental capabilities (Cordner, 2016). It is imperative that each policedepartment designs their own mission statement to benefit police employees and citizens (Cordner, 2016). The Spokane Police Department utilized service, pride, and dedication to provide organizational goals to their
  • 16. Change Of Milo In The Phantom Tollbooth In the book, The Phantom Tollbooth by Norton Juster, Milo, the main character, embarked on a journey with two others to rescue the two princesses, Rhyme and Reason. Milo changed a great deal throughout the book. In the beginning of the book, Milo was very ungrateful and was very unhappy. At the end of the book, Milo is a completely different person. Milo has learned to appreciate everything and is much happier. Milo changed at many points in the book, and I will be listing three of them. One place where Milo changed was on page 31, when Milo took a wrong turn and drove into the Doldrums because he was not thinking. Milo met Tock, the watchdog of the Doldrums, who gave him some good advice. Well, continued the watchdog impatiently, since you got here by not thinking, it seems reasonable to expect that, in order to get out, you must start thinking. This advice caused Milo to think more about what he was doing, thus changing him. This was an important place where Milo changed because it is the first place in the book where he changes.... Show more content on Helpwriting.net ... That wasn t bad at all the Humbug said, straightening his tie and brushing himself off. I must visit there again. I m sure you will, gasped Milo. But from now on I m going to have a very good reason before I make up my mind about something. You can lose too much time jumping to Conclusions. In this scene, Milo changed because he learned a lesson about the importance of having a reason before you do something. This was an important place where Milo changed because he realized that he hadn t had a reason for many things before he did
  • 17. How Caffeine Works Not A Drug Summary Summary This article talks about how caffeine works and how it may be considered a drug. The article starts out by saying that billions of people are addicted to caffeine and then explains the history of caffeine. It was originally used to protect against insects because the amount of caffeine in plants is toxic to bugs. Then, when the caffeinewas absorbed into nearby soil, the plant growth of nearby plants would be hindered. Because of this more and more plants evolved to contain caffeine and eventually it was discovered for human use in by Chinaand the Native Americans. After this more people discovered caffeine and it has now become a multibillion dollar industry. Then the article explains the effect caffeine has on the body. 3
  • 18. Failure of IMF and World Bank Policies in Sub-Saharan Africa Failure of IMF and World Bank Policies in Sub Saharan Africa Over the last several hundred years, Africa has been deprived of the peace that it so desperately needs. For over 400 years, Africa was subjected to the harsh trans Atlantic slave trade. Europeans and Americans brutally uprooted millions of Africans and shipped them away. Torn away from their homes, Africans were inhumanely exploited for their labor. The slave trade had a devastating effect not only on those involved, but also on future generations to come. The exploitation of Africans continued even after slavery was abolished. A new formof slavery disguised as colonialism quickly took form as an institutionalized method of exploiting Africans. European ... Show more content on Helpwriting.net ... In the following essay, I will show how the policies in place now are neither working but also making the situation worse. In order to solve the debt crisis in Africa, I propose the following three measures: 1)The Cancellation of all external debt 2)Investments in health, education, and infrastructure 3)New trade policies to fix the disparity in trade between African countries and industrialized nations. New methods need to be taken in order to at least curtail the region?s downward spiral. Cleary, the policies in place now undermine the economic development of African countries. The IMF and World Bank The IMF was established in 1945 by the United Nations to improve the health of the world economy. It was designed in order to avoid the catastrophic economic policies that had contributed to the Great Depression in the 1930s. The IMF is an international organization comprised of 184 member countries. It was established with the goal in mind of promoting international monetary cooperation in order to stimulate economic growth and provide temporary financial assistance to countries to help alleviate problems associated with debt. Acting as the central institution of the international monetary system, the IMF?s main objective is to prevent crises in the system by advising countries to implement reliable economic policies. It also provides funds that
  • 19. Housewife In The 1920 s In 1920 76.4 % of women had not yet joined the labor force. These women were still considered to be housewives. A housewife is a woman who takes of her home. She cooks, cleans, takes care of her kids and caters to her husbands needs. She was to put them first and put herself last. Although being a housewife was expected of women in the 1920s, it was not always what they wanted. Before the 1920s women were beginning to make a few changes because their husbands and sons were off to World War One. This meant women spent their time taking their place in the factories and other work areas, Which is less time at home and taking care of their kids. Women s employment rates increased during WWI, from 23.6% of the working age population in 1914 to between 37.7% and 46.7% in 1918 (TUC collections). Showing that before the 1920s many women were working like they never had before. Soon after, the men began to return home from war, and many women were fired and sent back home to be housewives once again. The women who stayed in the work field were pushed into more feminine jobs like nursing or being a secretary.... Show more content on Helpwriting.net ... There were things that were expectable to society and there were things that were not acceptable. They were expected to obey their husbands, do as they say, and to act in a manner that would uphold their husband s reputation. This included maintaining their appearance an acting appropriately in public settings. Once the women got married, they were expected to have children and take care of them. These women were to stay home and cater to their child s every need. People did not think that women had the same capabilities as men. Society did not even see these women as intelligent as their male counterparts. Women were not offered or even considered for the same types of jobs and they were not allowed to vote. Society looked down on them, simply because of their
  • 20. Poldark Season 3 Analysis As Poldark season 3 continues, the show is teasing another confrontation between Ross and George. One that has mostly been simmering in the season so far. Poldark is not necessarily at its best when it pits Ross Poldark and George Warleggan against each other. But, like it or not, their fates are effectively intertwined. Much as we love Demelza and Ross and their shared scenes, it s hard to deny that when Aidan Turner and Jack Farthing share a screen, there s generally some high quality (melo)drama. Fortunately, the show has not given up on pitting them against each other even with season 3 trying to keep them apart. In fact, Masterpiece has already put out a trailer that hints directly at the two of them squaring off yet again, this time over Ross new favorite brother in law (though the competition wasn t that strong, Drake ... Show more content on Helpwriting.net ... After all, he says, the people will rise up, and I will be powerless to stop them. The unlike last time is left unsaid, at least in this trailer, but it hangs heavy over the scene nevertheless. Ross does good things (sometimes), and they ve earned him some sway with people. Unfortunately, Ross has also spent most of the season in France, traveling to France, or thinking about France (with the exception of the winter grain purchasing, which was mostly handled by Demelza and Caroline anyway). Meanwhile, Drake has filled some of that popularity gap as well. And, well, it rather seems like George can t stand any of this. As a result, on one hand, we have Ross, finally focused on matters at home full time and finding himself going to bat for a brother in law that got shot trying to rescue Dwight. On the other hand, we have George, who s found himself stymied at almost every turn. NEXT: Riverdale: Dark Betty vs. Assertive Betty vs...Regular Betty? We re not saying there might be a problem for George even if Drake lives, but we re definitely thinking it very
  • 21. Advantages And Disadvantages Of Sulphuric Acid Uses of sulphuric acid Sulphuric acid is a very useful, referred as universal chemical because it is a commonly used chemical in the world and is used in a lot of manufacturing industries, for example, car battery, manufacturing fertilisers, refining crude oil, making phosphoric acid etc. This chemical is also known as one of the most important industrial chemical. This acid has helped us in many ways, making things easier for us. What is sulphuric acid? Sulphuric acid is a chemical compound, H2SO4. It is colourless, odourless and very corrosive causing burn. It is an oily liquid and is sometimes called oil of vitriol. Sulphuric acid can be produced by Contact Process. Combustion Chamber (combustion of sulphur) Converter (conversion ... Show more content on Helpwriting.net ... Positive environmental impacts This product of sulphuric acid, phosphoric fertiliser, can make fertile land. It can help farmers by making more land for them to grow crops. More soil nutrients are available for farmers to use. The farmers are able to use more land for farming efficiently instead of planting in small spots. Besides, the plant growth can be improved to protect the soil. More different plants can grow. The biodiversity can be increased. Negative environmental Impacts Even though this chemical is very helpful to farmers and is good for crop production. Over using chemical fertiliser can cause a lot of pollutions. For example water pollution occurs when the fertilisers are washed into rivers or sea. Besides, plants or crops do not absorb the fertiliser one hundred percent. They only absorbs a portion of the fertilisers leaving some remaining in the soil. When the fertiliser goes into the water, micro organism can grow like algae. This can cause eutrophication because the algae grows faster on the fertiliser washed into the sea. This can cause the algae to take up a lot of oxygen from the water. This can cause lack of oxygen in the water for the fish, suffocating the fish that lives in the area. The ecosystem will be disturbed due to the large numbers of death of
  • 22. Generally, In A Political Science, The Notion Of... Generally, in a political science, the notion of accountability can be interpreted as an answerability of actions, and responsibility to the constituents of the government officials (Seymour 1995, pp 9). However, there are many different kinds of ideologies regarding the judicial accountability. Some scientists argue that the notion of accountabilityhas the same meaning either in the political arena or in the judicial system. Such as, Sengupta (2014) argues that, likewise accountability in the political arena, in the judicial branch, the notion of accountability relates to the ambit of judicial resolution, which means while making judicial decisions, judges are responsible for their decisions, and answerable to their constituents of... Show more content on Helpwriting.net ... The last part of the taxonomy covers non instrumental (an exercise of power is a basic source of accountability) and instrumental (such as disclosure of annual income) occasions. However, Sengupta does not clearly consider the question of to whom the judiciary should be accountable. According to his determination about the judiciary accountability, it can be seen that the judges and the judicial system should entirely accountable to politicians. In this case, the notion of the Separation of power will be rejected. Therefore, according to the notion of the separation of power, the state power should be separated into three different, independent bodies. If the judiciary system is accountable to the politicians (parliament), who established its institutions, then the judicial resolutions will be influenced by the politicians. Based on an idea of guarantees of judicial impartiality, which is an essential basis of the democratic ideology, another scholar Daniela (2010, p.p. 24 34) considers legal, institutional, professional, managerial and societal accountabilities of the judicial branch. The legal accountability is formed by the notion of the rule of law, which means 1.The State is the only subject that can control society; 2.The control should be exercised through law; 3.The law s initial purpose is achieving social purposes; 4.Citizens have equal rights to the law;
  • 23. The Emperor Penguin And The Great The Emperor penguin and the Great norther diver they are both are from the class Aves (Magnuson, 2007) .In addition, the emperor penguin since is in the class Aves, the penguins used to be able to flight which is an adaptive trait. But, since they are bigger, heavier, and better at swimming the trait was lost over time (Elliott et. al, 2013).In addition, physiologically the common loon looks different very different from the Emperor penguinlooks bigger and can t fly. In the other hand the common loon is small, is able to fly, swim, but can t walk (Mager et. al, 2017). Both, species have evolve to either loss or gain traits over time to adapt to their environment. Both species are in the same class but, have different niche in the environment. The emperor penguin can be found in the open ice of Antarcticaand they are considered sea ice obligate species (Fretwell et. al,2014).Emperor penguin, has an advantage in their environment since there are no predators and completion for the resources they eat. Moreover, their body temperature surfaces cool beneath the air temperature since they life in a cold environment (McCafferty et al,2013).In addition, the environment in which Emperor penguin live on is harsh, but they are the only vertebrate species that breed during the Antarctic winter and the reason are not yet known ( Zitterbart et. al,2014).As a result, the climate change in their habitat Emperor penguin are in jeopardy and their population will decline since the
  • 24. Lake Michigan s Radiography Program I was excited when I was accepted into Radiologic program at Lake Michigan, a year earlier I was very disappointed when I missed the deadline to apply into the program because I was missing one of the required prerequisites to get into the program. I had to wait a full year to apply again and I was very happy when I got accepted into the program, it was hard to hide my excitement during the first semester, I was charged and ready to go. As part of the Radiography program, for the two years we are in the program we are required to do clinical rotations at hospitals or clinics in the surrounding areas. They were usually 24 hours a week during the fall and winter semesters and 40 hours a week during spring and summer semesters. There were times I had to drive an hour just to get to a clinical rotation. Although every semester was ... Show more content on Helpwriting.net ... I should have waited until I knew the people better at the new clinic before attempting to test on the assessment. I later found out although it is not required students who were ready to test will check they cassettes for films, because for some reason some of the Technologist will forget or didn t care to replace the film. As a student at a new place it is better to know the people, what they like, how they work, and what they expect from you. I failed in both of those categories and it was an important learning experience for me personally although the failing grade was rescinded and I was made to retest with the same lady again. After the assessment I reported to the Clinical Coordinator what happened and how I felt I received the wrong grade for an assessment I passed, because someone forgot to put a film back in the cassette. Our clinical instructor did a great job by choosing that moment as a teaching moment for the whole
  • 25. How Did Rome Influence Greek Culture Ancient Greek history has played a vital role in cultures throughout time. From its neighbors in Europe to all the way across the Atlantic, ancient Greece has influenced many nations. From United States to Canada to Mexico, the influence of Greece can still be seen today. While the influence of ancient Greeceis grand, there was one place that was so enamored by the Greek way of life, that they seemingly adopted it as its own. The culture of ancient Romeso closely mirrors that of ancient Greek society that it is not uncommon to mix the two up. Since the Roman Empire did not flourish until after the Greek downfall, it is known that the Romans were directly influenced by the Greeks. Assimilation Of Greek cultural traditions created a bizarre situation, in which Rome was culturally Greek, but it was culturally unique, as it still retained influences from early Italians. While it is obvious that the Romans were influenced by the Greeks, one may wonder when this cultural assimilation of Greek culture began. The Roman conquest of Greece was a period in time where The Romans and the Greeks were at war and how eventually Greece became one of the first provinces of the emerging Roman Empire. The Romans had an emigration for Greek culture in a sense that ... Show more content on Helpwriting.net ... The first are the Pyrrhic Wars and the second are the Macedonian Wars. Tarentum was the greatest city in Italy after Rome and in the late 280 s the Romans decided to install garrisons in several Greek cities. The citizens of Tarentum regarded this as an imperialist move: the garrisons would be followed by a more permanent Roman presence and accelerated Romanization (Waterfield 12). In an effort to placate the anxious Tarentines a Roman envoy delivered a speech in Greek, to which the Tarentines decided to mock his mishaps. With the knowledge that they would not succeed in defeating the Romans on their own, they had to search for assistance
  • 26. Aesthetic Representation Aesthetic Representation The relationship with my patient was built upon communication. As my patient didn t speak much English, I was able to speak to him throughout clinical in Spanish. The Spanish language was an imperative aspect of our relationship, being able to speak in this language allowed my patient to freely talk to me without difficulty. Our relationship was like a book, as each time I spoke with him about something new, I would be turning to a new page with a different passage being read. Each of these pages are read in Spanish, as I spoke to my patient in this language. The pages represent something I said in Spanish to my patient during clinical. So, when a page in Spanish is turned, the next page would be a translation into English. Patient and Clinical Experience My patient is an 86 year old male. He was admitted to 3 East with a diagnosis of sepsis caused by Klebsiella pneumoniae. The chief complaint that brought him... Show more content on Helpwriting.net ... The reflections allowed me to evaluate why my patient was admitted and find supporting facts for their diagnosis. I helped me see many different connections of how one thing in patient s condition can affect something else. Though the clinical reflections were long, but I do believe that they helped me a lot in understanding the things that led to my clinical judgements. One thing that I ll do to prepare myself for next semester is to practice all of my skills that I ve learned during CFL clinical this semester. I believe that by practicing these skills, it will help me be prepared to perform any skill that needs to be done during clinical. It will help build my confidence up and help me trust myself when I m given a task to complete. By reviewing all the skills and skill videos, it will assure myself that I know what I m doing during future
  • 27. Blitz Unit 3 Unit 3 Essay Question # 2: Utilizing the information in the textbook (particularly Figure 11 2 and 11 3) discuss the similarities and differences between an arson and a bombing investigation. The sirens wailed, blue, and white lights from the wig wags flashed, as numerous alphabet soup agents pulled their police vehicles up to the front of the hotel parking garage. The Local PD set up an outer perimeter by blocking off street intersections and conducted traffic control. The inner perimeter or red zone was located on the top floor of the parking garage. EOD personnel conducting an intel briefing. Apparently, a hotel worker reported seeing a suspicious device under the massive hotel air conditioning unit located on the top deck of the parking ... Show more content on Helpwriting.net ... Arson investigators search for trace evidence such as accelerant odors, plants, or trailers left behind at the fire scene. Bombing Investigators search for physical evidence, explosive residue, bomb parts, or secondary devices left at the bombing scene. The investigators also search for video evidence from security cameras in the area. The fourth step in the investigative process is building the case. The theory, origin, and target of the fire or explosion is sought. Investigators use the gathered evidence to figure out the motivation of the arsonist or bomber, and whether driven by psychological issues, political reasons or financial gain. The technical expertise of the arsonist or bomber, is only limited by their resources and imagination. The most crucial aspect in both arson and bombing investigation is the identification and arrest of the suspect. Investigators search witness and police intelligence reports for possible leads and suspects. The physical evidence, taggants, or micro particles left behind at the crime scene, is analyzed at a forensics laboratory in order to trace it back to a specific business or individual. The information gleaned from witnesses, reports, and evidence, often lead to the identification and arrest of the
  • 28. Langston Hughes Should Be Required In The Norton Anthology... Collectors of poetry are bias. By this I mean that more often than not when poems are selected for collections, the works of classical writers will be prioritized over the works of newer or more untraditional authors. That is not to say that this is a bad thing, there is much that can be and needs to be learned from classical poets. However, it is often overlooked how much other, more unknown writers can contribute to the canon of poetry, especially those influenced by different racial and ethnic backgrounds. To demonstrate my point, in this essay I shall be discussing in detail Langston Hughes and his piece Poem and why it should be included in the Norton Anthology of Poetry. I will contrast and compare it with Christina Rossetti s Remember, and back up my arguments with selected quotes from Langston Hughes essay The Negro Artist and the Racial Mountain . To begin, Langston Hughes Poem is an example of how few words can still hold a deeper meaning. Using repetition, punctuation, and free verse, Hughes crafted a poem that was elegant yet powerful in its simplicity. I loved my friend. He went away from me. There s nothing more to say. This poem ends. Soft as it began I loved my friend An American poet born in 1902 in Missouri, Hughes came from a family with a past closely tied with the fight against slavery in America. In fact, race in America was still to play a large role in his life, and be something that he had a very strong opinion on. And it may be for
  • 29. Tattoo Cultural Phenomenon Tattoos have been around for thousands of years and tons of people today have joined in with the trend. A article published by the Huffington Post states that Today, 36 percent of Americans 18 25 have at least one tattoo (page 1). Tattoos are now a cultural phenomenon due to various different things and people that are making them a phenomenon. Tattoos weren t as common 25 years ago. The Huffington Postalso said that those body modifications were only seen on sailors, inmates, and bike gang members (page 1). But today, you will see tattoos on the body company presidents, accountants, doctors, managers, and more because it is something that has become more acceptable overtime. According to the Huffington post, The start of the cultural ... Show more content on Helpwriting.net ... The Huffington Post claims that Celebrities like Rihanna, David Beckham, Angelina Jolie, and Adam Levine, are several examples of mainstream media icons that have tattoos and openly display them (page 1). A cultural phenomenon occurs when certain individuals behave a certain way merely because other individuals do as well. Celebrities getting tattoos is a perfect example of a cultural phenomenon because the celebrities are the individuals that started the trend and then their fans start to get the same tattoos because it considered cool since the celebrities did it first, causing a bandwagon effect. The people who are getting tattoos come from all walks of life. The canvases are teenagers and young adults, women, African Americans, Latin Americans, urbanites, suburbanites, white collar professionals,and the college educated. As you can tell there is a diverse group of people that are getting tattoos, it s not just one culture getting them so having tattooed bodies is something that is becoming more popular for all cultures and is also becoming a trend that everyone wants to be a part of. Tattoos are a big cultural phenomenon in today s world, because they are something that everyone can get and they are something that helps people express themselves and they are a way for people to show their creativity. People are getting tattoos everyday and that trend will continue for many years to come because people like
  • 30. helmet law Essay Who are Relmets Really Protecting? The debate over whether or not to wear a helmet while riding a motorcycle has been hot topic since the helmet law went into effect in California in 1992. It seems obvious that wearing a helmet would help protect you in a motorcycle accident. Many legislatures agree. In fact, nineteen states have a mandatory helmet law for all motorcycle riders. Twenty seven states have a law for those under a set age, three of which require additional insurance for those of age who choose not to wear a helmet. That leaves only four states with absolutely no helmet laws. Despite these facts, helmets are a superficial means of safety at realistic speeds. Yet because this is a public policy issue that is not just about ... Show more content on Helpwriting.net ... Insurance companies are in the business of making money. It s the opinion of the insurance companies that if a rider wears a helmet, he or she is safer and less likely to suffer serious injuries in an accident. Fewer injuries equal fewer claims and more profit for the company. It s not very hard to see why insurance companies are supportive of the helmet law. My own opinion in regards to support of the helmet law is this: very little is presented by major medical research that would indicate that one is safer on a motorcycle wearing a helmet during an accident. Most research states that a helmet is only successful from preventing serious injury while driving less than 15 mph (DOT Helmet test, 1999). Most accidents on a motorcycle occur at a higher rate of speed making the helmet useless. In fact, accidents involving helmeted riders often result in serious neck trauma even when the helmet doesn t come in contact with any foreign objects. The National Highway Traffic Safety Administration (NHTSA) web site lists that there were a total of 323 motorcycle fatalities in California in the year 2002 (DOT California, 2002. Of those 323, 274 were wearing a helmet, 45 riders were not. Not the type of numbers that would make you strap on a helmet. Wearing a helmet often times provides a false sense of security. The risk of injury and even death is very high while riding a motorcycle. The NHTSA also points out that the majority
  • 31. A Wonderful Monograph By Melissa Archer Introduction This is a wonderful monograph by Melissa Archer with a comprehensive study of the theme of worship in the Apocalypse . It illustrates various aspects of worship and the role of worship in the Apocalypse. The language of the book and different approaches to the theme are appreciated, because those are simple and clear to understand the theme. Summary of the book The context of the book is well organized. Archer divides her text into five chapters, and every chapter has an introduction and a summery, which is really helpful to read and get the message at the first glance. Chapter one is a survey of modern scholarly literature related to the theme of worship in the Apocalypse. It is divides into four subtopics; A) The theme of worship as a whole, B) The hymns in the Apocalypse, C) Revelation 4 5, D) Additional worship scenes. Chapter two is focused on the methodology for the study engaging North American Pentecostalism and Pentecostal hermeneutics. In this chapter she introduces the term Wirkungsgeschichte ; how to discover the worship in the Apocalypse. Chapter three is a careful reading of the early Pentecostal periodical materials. She explains how the worship practices of early Pentecostals using both the Wesleyan Holiness and the Finished Work traditions during the time period of 1906 1916. Chapter four is focused on a sustained narrative reading of the Apocalypse with the theme of worship. In addition to the prologue and epilogue, there are four
  • 32. What Was The Potato Famine Was the Potato Famine an accident? It had little to do with the declines in food production. The bad seasons were the cause of the death that happened during this time. You would think that the main cause of the potato famine would be plant disease, but England s long running political hegemony over Irelandwas a huge factor. Since the demand for potato s was higher there was a greater need to supply more, and so then everyone started on the frenzy for potato s. When there was a strain of Phytophthora infestation caused the widespread devastation of potato crops in Ireland and Northern Europe. The system started to fail, and the demand for food (potato s) became greater, and then the supply of them was not met. During this time there
  • 33. The Implementation Of Credit Rating Agencies Credit Rating Agencies (CRAs) have also been blamed for their role in promoting risk taking behaviour. The Basel II Accord (2004) also gave CRAs a major role to play in financial markets. The complexity of MBSs and CDOs increased overtime, making it difficult for the agencies to assess their risk accurately. They underestimated the complexity of these mortgages and were slow in downgrading the ratings during bad times, so that their ratings misled the market participants. Overtime, various institutions made loans without verifying income and offered floating rate mortgages with payments that were affordable only initially but increased greatly overtime. Subprime lending became a norm rather than an exception. Eventually borrowers ... Show more content on Helpwriting.net ... The structure had always carried the risk of the crisis going global. Investor confidence stumbled globally, the negative sentiment spread throughout the market and no one wanted to buy these securities, leading to a crash in their prices. Banks, having to use Mark to Market accounting practices, were forced to write down losses on these securities into their balance sheets. This resulted in large losses across the banking industry in the third and fourth quarters of 2007 (Tiller, 2010). Bear Stearns finally collapsed on March 16, 2008 and was later sold to JP Morgan Chase. Lehman Brothers, one of the major investment banks in the US, held massive amounts of CDOs and MBSs in their portfolio and was therefore nearing bankruptcy. The CRAs gave the bank the ultimatum to find a buyer or else face a cut in its ratings. Lehman Brothers ultimately filed for bankruptcy on September 14, 2008 due to its inability to raise capital or find a buyer. They had expected that the government would bail them out but that did not happen. This came up as the first big blow to the financial markets. There was another instrument that aggravated the whole situation. These were the unregulated, over the counter derivatives, including Credit Default Swaps (CDSs), that were sold as an insurance against default on MBSs. AIG sold huge amounts of these insurance policies, without having enough money to back them up when
  • 34. EMail Privacy Rights In Business Essay E mail Privacy Rights In Business I.Abstract How far we have come in such a small time. When you think that the personal computer was invented in the early 1980 s and by the end of the millennium, several households have two PC s, it is an astonishing growth rate. And, when you consider business, I can look around the office and see that a lot of the cubicles contain more than one PC. It is astonishing to me that such an item has taken control over the information technology arena like personal computers. Consider, however, the items that go along with personal computers: printers; modems; telephone lines for your modem; scanners; the software; online access; and lets not forget, e mail addresses. E mail, or electronic ... Show more content on Helpwriting.net ... Among these dangers is privacy, in particular, what legal rights corporations and employees have in keeping their communications private. This paper will introduce the current legislation in this area, the expectation of privacy an employee should have, any court decisions that provide additional ruling, and what a corporation can do to prevent litigation in these matters. II.Employees Expectation of Privacy in e mail As an e mail systems manager, I was under the impression that since the company owns the electronic messaging system, the company could view the contents of any employees e mail account at any time. I was only partially right. The explanation of the current law will describe this in detail, but, the employee does have a certain right to privacy where e mail is concerned. Arguably, a company s most valuable asset is it s data. In the age of technological marvels, it is easier to create more valuable data and, on the other hand, that data is more easily retrievable, especially by persons not authorized to obtain the data. Employees of companies can expect a certain right of privacy granted by three main sources: (1) The United States Constitution; (2) Federal Statutes (The Electronic Communications Privacy Act of 1986); and (3) State Statutes (many of which have not addressed the issue). The United States Constitution provides a limited group of employees with privacy safeguards. The safeguards are based
  • 35. The Death Of A Star Palacios 1 Kimberly Palacios English 1A 60 Professor Kathleen Gurnett 29 October 2015 Just Like Humans If a person was to be asked to describe our life stages, they would probably say something like people are born, they live, and then they die. Of course, they aren t wrong, but we humans go through beautiful stages before reaching death. We go through stages such as infancy, childhood, adolescence, and adulthood. In many ways, Stars are just like humans. They also go through astonishing stages, all leading up to its death. The death of a star will probably be one of the most beautiful and terrifying moments we wont get to witness. But our sun being such a key factor in our everyday life, is reason enough to know the importance of its life cycle and the process it will undertake as it begins to perish. But in order to understand how and why a star dies we first must ask ourselves: what exactly makes up a star? We might look at the sun and think Hmm, well it just looks like a big ball of fire to me. Good! The sun is a big ball of fire, but it doesn t burn exactly like fire, it s more a burning glow. This glowing heat, which is about 10,000 degrees Fahrenheit, is not produced by burning like in a chemical reaction but rather by fusion like in a nuclear reaction. Now, to understand how the sun enters the final stage of its life cycle, it is important we fully understand how the sun was created. For humans, one of the earliest stages of life is birth. A human is
  • 36. Art Spiegelman s Maus A remarkable work, awesome in its conception and execution... at one and the same time a novel, a documentary, a memoir, and a comic book. Brilliant, just brilliant. Jules Feiffer (1) This is a commentary by Jules Feiffer about Maus , which is a survivor s tale created by Art Spiegelman. As you can see from the commentary, this is a wonderful story, not only its the writing but also the art. The author made the story interesting that attracts many readers by changing many things from the first 3 page version of Maus. To analyse this story, first of all, we need to understand about the writing of this story. Spiegelman focuses on many things in this story and the events in 1940s made them connected. In chapter 1, Vladek is a ... Show more content on Helpwriting.net ... The author wanted to focus on the emotion of characters who lived in this period. Because this is a graphic novel, the art is also an important things to analyse. It can support the character s emotion in the writing. While the first story is painted cartoonishly because it s a bedtime story for children, the latter one is painted realistically. It makes sense with the style of writing. Spiegelman didn t write realistically but the art is cartoonish. Realistic art can show the real emotion of the characters. As we can see in chapter 2, when Vladek spilled his pill box twice, his face and his action showed embarrassment. When the author wrote about the difficult times in the 1940s, the painting represented the difficult life condition. The way that he drew a rat when Vladek and Anja lived in Kawka s cellar was very meaningful. In Western countries, rat is the animal that many people scared. In general, it s hard to find a rat in a Western s house. So this was a really hard life condition of Vladek s family. We can also see that although Vladek was very scared with rat, he still kept Anja pacing. Readers can understand clearly about not only Vladek and Anja s hard condition but also the true love of Vladek to Anja. It supports many things that were focused in writing. In this manner, the images are fitted together classically. Each is drawn in a square and the script is above. It makes readers easy to read the writing and see the picture. It isn t a very
  • 37. Rhetorical Speech In Tamburlaine The King By William... B orn only two months before Shakespeare and dead before he was thirty, Christopher Marlowe, considered to be the first English tragic poet, began and ended his literary work while Shakespeare was still at the beginning. His earliest tragedy, Tamburlaine the Great, was a path opener for the possibilities of Elizabethan tragedy. It was followed by other three tragedies, Dr Faustus, The Jew of Malta, and Edward II. In the prologue to his first piece, Tamburlaine, the playwright announced his intention to use in tragedy high astounding terms. Arrogantly, he denounced the jigging veins of rhyming mother wits who had previously been devoted to tragedy. In spite of his wide literary studies and sympathies, Marlowe was a rebel in essence. He ... Show more content on Helpwriting.net ... This read: Tamburlaine the Great. Who, from a Scythian shepherd by his rare and wonderful conquests became a most puissant and mighty monarch, and (for his tyranny, and terror in war) was termed The Scourge of God. Divided into two tragical discourses, as they were sundry times showed upon stages in the City of London by the right honourable the Lord Admiral his servants. In addition, Part II s emphasizes were later given the following description: The second part of the bloody conquests of mighty Tamburlaine. With his impassionate fury for the death of his lady and love, fair Zenocrate, his form of exhortation and discipline to his three sons, and the manner of his own death. Rare and wonderful conquests by a shepherd turned monarch, notorious for his tyranny and terror in war this is the kind of tragedy implied by this extended tide. One of the later reprints added a heading that reads The Tragical Conquests of Tamburlaine still another indication of how flexibly the adjective could be applied. Rather than referring primarily to a formal or structural pattern, or even to a disaster that follows a protagonist, tragical linked to discourses and conquests denoted a style or a quality. Marlowe s short but characterizing prologue to Part I includes a similar
  • 38. Baz Luhrmann Romeo and Juliet is a classic well known play, a tale of two lovers that cannot be together. Many books, plays, and movies have based off of this then directors have remade it into their own visions. Two films that we have seen were different interpretations of this play one being by Franco Zeffirelli in 1968 and Baz Luhrmann 1997. In the case of interping and showing what Shakespeare would have wanted to see I think Franco Zeffirelli had shown it better. He showed what the characters were truly like and how they lived. Franco s set was during the renaissance period in the city of Verona, while Baz Luhrmann was in the present day. The director used the setting to make it a more serious with themes of romance and tragedy. I feel as if that was what Shakespeare was going for to make it a serious topic as it has a powerful message. Baz Luhrmann was creating a different point of view on the story as if it was told today. Though Shakespearean plays had outfits of the current day in their time, Shakespeare wrote it for medieval or early renaissance times. Franco was showing a current day for that time showing the true origins of the story.... Show more content on Helpwriting.net ... There were some moving shots to help catch the action happening to the characters. In Baz Luhrmann s movie he has the camera moving many times zooming in a characters face or onto something else. This caused a more whimsical feel, we are not able to focus on something causing more confusion. It takes away the darkness of the story and instead shows more joy and fun. The movie was in a more cool tone compared to Baz Luhrmann who had the movie in a warm tone most of the time. This gave the audience a more calm and serious feeling showing us more the dark lives the characters
  • 39. The Pros And Cons Of African Americans In Reconstruction The Civil War ended in 1865 and while the thirteenth amendment was being passed lots of African Americans faced problems. With the death of Abraham Lincoln, Andrew Johnson became president and while he worked with Lincoln he lacked Lincoln s critical thinking and thought that African Americans shouldn t be involved in reconstruction. The definition of freedom is the power or right one has to speak and think as one wants without restraint. Although African Americans were still being treated like vermin by whites and struggled economically they were politically free. In the year 1866, the Civil rights act was passed and it allowed African Americans to own property and be treated equally in court. The only problem with that was the south refused to obey the laws. Once Johnson pulled all the men out of the south who were suppose to protect the rights of African Americans everything fell apart. Henry Adams was traveling and six miles south of town he was beaten by four white men with sticks. The men threatened to kill every Negro that claimed he did not belong to anyone.On his way to Shreveport, he noticed twelve colored men and women beat, shot and hung ( doc D). So, while blacks were free many people in the South believed the there way of life was better and continued to treat African Americans poorly. It got to the point where President Johnson came up with new rules for African Americans that they would abide by. These new rules were called the Black Codes (C). The Black
  • 40. Protein Based Ligands For Tumor Targeting In addition to peptides, protein based ligands such as Affibody proteins have been utilized for tumor targeting. Anti epidermal growth factor receptor (EGFR) Affibody protein (e.g., Ac Cys ZEGFR:1907, amino acid sequence: Ac CVDNKFNKEMWAAWEEIRNLPNLNGWQMTAFIASLVDDPSQSANLLAEAKKLNDAQ NH2) is used to target EGFR that is overexpressed in a wide variety of human tumors. Cheng and co workers used anti EGFR Affibody proteinas tumortargeting ligand on 64Cu Au IO nanoparticles (PET component: 64Cu, MRI component: iron oxide, specific for EGFR) surface.[63] In their work, A431 tumor cells were subcutaneously implanted in the right shoulders of nude mice; and 64Cu NOTA Au IONP Affibody nanoparticles were administered via tail vain injection. Rather low resolution PET image showed that these nanoparticles were taken by EGFR positive A431 (human epithelial carcinoma cell line) cells reaching 4.6% ID/g at 24 h after injection, significantly higher than that obtained from the blocking experiment (1.9% ID/g) indicating the specificity of the probe. This difference in % ID/g values corroborated with 44% drop in MRI signal intensity that was observed for the tumor. In this study, the use of an Affibody protein as ligand for EGFR expressing tumor in small animals was demonstrated to be successful; however, the benefit of multimodality was not demonstrated. The unique chemistry of this dumbbell shaped Au IO nanoprobe could pave the way for targeted drug delivery into EGFR expressing tumors
  • 41. Censorship Of The World Wide Web We live in the age of information, a world that has now been largely digitalized. The World Wide Web is the central component of our era, as it allows people across the globe to share and receive information in an instance. It used to take months before a letter from China could reach the U.S, now it just takes a second with E Mail. This fast pace information processing has allowed human society to move forward with unprecedented speed, but it also raises many concerns for government authorities. Sharing information is a powerful tool, and too much of it will make any government nervous. Censorship of information has had a long history throughout the world. In ancient China for example, censorship was considered a legitimate instrument ... Show more content on Helpwriting.net ... That is a 718% increase compared with the 757 items that Google had to remove in the six months prior (Suter). Dorothy Chou, a senior policy analyst at Google wrote in her blog post, It s alarming not only because free expression is at risk, but because some of these requests come from countries you might not suspect Western democracies not typically associated with censorship. Other countries can also send in requests to Google and ask them to take things down, but Google rarely complies with those requests. Being a U.S based company; Google has complied with 93% of the government requests from our own government authorities. It only complied or partially complied with only 24% of such requests from Canada, and 44% from France (Sutter). The numbers are significantly lower, which shows that Google is clearly under more pressure by the U.S government. Other nations like China and Russia have completely banned Google all together. These data suggests that the U.S government also actively monitors the World Wide Web, George Orwell s worst nightmare. The U.S. government has even gone as far as to ask Google for data on its users more than 31,000 times in 2012 alone. Google said that they ended up turning over at least some data in every single case (Quain). However, some have argued that these monitoring isn t all that bad. Censorship to some extent, as some would argue, is to
  • 42. The Big Data Related Activities The world is changing with respect to the growth in big data and to the way in which it is used. Growth in big data brings with it many challenges, but it also presents new opportunities. Figure 1, helps understand some of the big data related activities that are taking place in the world with respect to volume of data that is being consumed by these activities over the next 5 years. Fig. 1: Data is predicted to grow to more than 160,000 terabytes in the next 5 years. Apple was Teradata s fastest ever customer to a petabyte and, is operating a multiple petabyte Teradata system. Walmart s operational system was at 3 petabytes as of 2009, and uses separate ones for Walmart, Sam s Club and a backup system as well. eBay s primary data... Show more content on Helpwriting.net ... Retailers are partnering with data providers and consumer databases to meet customer experience expectations. It is important for brands to stand out as increasing number of consumers are starting to shop online. Quality data can give marketers unique insights so that they can target highly personalized digital marketing provide a great shopping experience. The global big data integration software leader, released findings from its survey at the impact of the cloud on data and application integration. The survey carried over 100 IT managers and directors. The results detail current cloud usage and showcase the growing demand for cloud based data storage, integration and analytics. An enterprise manages eight SaaS applications on an average. Oracle, SAP, Salesforce and Dropbox are among the most frequently SaaS apps in use. Cost is cited as the prohibiting factor by companies that are yet to incorporate a good number of Saas applications. However, there are a few companies who do not consider it to be a priority and have integrated SaaS apps with others. Companies having cloud integration platforms and integration Platform as a Service solutions, have big data on the top of the priority list of additional capabilities. Big Data gives one the ability to collect, manage and analyze large amounts of data, leading to changes in the way companies deal with customers, resulting in increased profits and a competitive edge over other companies. Big data is
  • 43. Teenage Alcoholism 1.According to statistics on alcoholism and alcohol abuse statistics, even though alcohol has been used in a number of diverse ways. a.Throughout history these ways can be called useful, however, known thousands of years ago that abusive and excessive drinking led to negative outcomes and adverse alcohol side effects. b.The symptoms associated with this are mostly societal and personal problems. 2.Research studies have shown that teenage alcoholism is correlated to the age at which teens start drinking and to the amount and the frequency of their drinking. 3.More precisely, the average age when teenagers first try alcohol is 11 years old for boys and 13 years old for girls. a.The earlier teenagers drink, the more they ... Show more content on Helpwriting.net ... teens who drink alcohol are 50 times more likely to use cocaine than teens who never consume alcohol. d.Research indicates that adolescents who use alcohol may remember 10 percent less of what they have learned than those who don t drink. e.In the U.S., problem drinkers are mostly found in young adults between the ages of 18 and 29 C.Statistics of alcohol and teens 1.Some studies done by NIAAA (National Institute on Alcohol Abuseand Alcoholism) have shown the following: a. Prevalence in 8th graders: i. 51.7% have tried alcohol ii. 43.1% have had an alcoholic drink in the past year iii. 25.1% have been drunk iv. 15.2% have had 1 or more binge drinking episodes 2). Prevalence in 10th graders: i. 70.6% have tried alcohol ii. 63.7% have had an alcoholic drink in the past year iii. 48.9% have been drunk iv. 25.6% have had 1 or more binge drinking episodes v. 1.9% have been daily drinking for at least 1 month at some point in their lives 3). Prevalence in 12th graders: i. 80% have tried alcohol ii. 73.8% have had an alcoholic drink in the past year iii. 62.3% have been drunk iv. 30.8% binge drank in the past 2 weeks v. 3.6% use alcohol daily 2. In 2012, nearly three quarters of students (72 percent) have consumed alcohol a. by the end of high school, and more than a third (37 percent) have done so by eighth grade 3. From these statistics, you can see how widely abused alcohol really is.
  • 44. Research Specific Risks, Threats, And Vulnerabilities On... Research specific risks, threats, and vulnerabilities to Web and social networking applications Social networking worms: Social networking worms include Koobface, which has become, according to researchers, the largest Web 2.0 botnet. While a multi faceted threat like Koobface challenges the definition of worm, it is specifically designed to propagate across social networks (e.g., Facebook, mySpace, Twitter, hi5, Friendster and Bebo), enlist more machines into its botnet, and hijack more accounts to send more spam to enlist more machines. All the while making money with the usual botnet business, including scareware and Russian dating services. Trojans: Social networks have become a great vector for Trojans click here and you get: Zeus a potent and popular banking Trojan that has been given new life by social networks. There have been several recent high profile thefts blamed on Zeus, notably the Duanesburg Central School district in New York State late in 2009. Once a Zeus Trojan infects a machine, it remains dormant until the end user visits a Web page with a form to fill out. One of the toolkit s most powerful features is that it allows criminals to add fields to forms at the browser level. This means that instead of directing the end user to a counterfeit website, the user would see the legitimate website but might be asked to fill in an additional blank with specific information for security reasons. URL Zone is a similar banking Trojan, but even