SlideShare une entreprise Scribd logo
1  sur  63
Télécharger pour lire hors ligne
e‐Human Beings:
The contribution of internet ranking 
systems to the development of 
human capital
Barry Smith
http://ontology.buffalo.edu/smith
Rate‐my‐professor
surely '
Simple on‐line rating systems improve 
our lives
A taxi‐summoning app
Uber allows customers to rate drivers
• for punctuality, cleanliness, and so forth. You 
can then ues these ratings in making bookings 
in the future. 
But then, when the leave the taxi, the drivers 
rate the customers, and these ratings too are 
stored in the system
Behind the scenes, good behavior is 
being rewarded and bad behavior 
punished
customers who vomit in the cab, or who refuse 
to pay, or who behave aggressively will find 
themselves restricted in their use of Uber in the 
future
e‐people
A new theory of personal identity:
You are a biological organism (with plans, skills, 
qualifications, titles, etc.) together with a 
reputational trail
– increasingly, your reputational trail is a 
matter of your rankings on internet ranking sites
– including more or less secret rankings on 
cites such as Uber, match.com, and SCHUFA
For academics, today, the most important 
ranking site is google scholar
New Possibilities for 
Scholarly Research
24
Jürgen Habermas
Saul Kripke
Jerry Fodor
Hilary Putnam
http://ngrams.googlelabs.com/graph?content=ontolo
gy,metaphysics&year_start=1700&year_end=2008
New Possibilities for 
Biological Research 
38
MKVSDRRKFEKANFDEFESALNNKNDLVHCPSITLFESIPTEVRSFYEDEKSGLIKVV
KFRTGAMDRKRSFEKVVISVMVGKNVKKFLTFVEDEPDFQGGPISKYLIPKKINLM
VYTLFQVHTLKFNRKDYDTLSLFYLNRGYYNELSFRVLERCHEIASARPNDSSTMRT
FTDFVSGAPIVRSLQKSTIRKYGYNLAPYMFLLLHVDELSIFSAYQASLPGEKKVDTER
LKRDLCPRKPIEIKYFSQICNDMMNKKDRLGDILHIILRACALNFGAGPRGGAGDEE
DRSITNEEPIIPSVDEHGLKVCKLRSPNTPRRLRKTLDAVKALLVSSCACTARDLDIFD
DNNGVAMWKWIKILYHEVAQETTLKDSYRITLVPSSDGISLLAFAGPQRNVYVDDT
TRRIQLYTDYNKNGSSEPRLKTLDGLTSDYVFYFVTVLRQMQICALGNSYDAFNHD
PWMDVVGFEDPNQVTNRDISRIVLYSYMFLNTAKGCLVEYATFRQYMRELPKNAP
QKLNFREMRQGLIALGRHCVGSRFETDLYESATSELMANHSVQTGRNIYGVDFSLT
SVSGTTATLLQERASERWIQWLGLESDYHCSFSSTRNAEDVDISRIVLYSYMFLNTAK
GCLVEYATFRQYMRELPKNAPQKLNFREMRQGLIALGRHCVGSRFETDLYESATSEL
MANHSVQTGRNIYGVDFSLTSVSGTTATLLQERASERWIQWLGLESDYHCSFSSTR
NAEDV
New biology data
39
Old biology data
40/
The Gene Ontology
response to the massive opportunities 
created by the success of the Human 
Genome Project
for cross‐organism biology
for intra‐organism biology
for the biology of environments
41
You’re interested
in which genes
control heart
muscle
development
17,536 results
42
43
Definitions
44
Gene products involved in cardiac muscle development in humans45
47
Google hits Jan. 2004
ontology + Heidegger 58K
ontology + Aristotle 77K
ontology + philosophy 327K
ontology + software 468K
ontology + database 594K
ontology + information systems 702K
48
Comparison 2004/2012
ontology + Heidegger 58K 1.91M
ontology + Aristotle 77K 1.66M
ontology + philosophy 327K 4.91M
ontology + software 468K 7.80M
ontology + database 594K 10.20M
ontology +information systems 702K 5.14M
how deal with oral cultures?
can be applied to mathematics too
how does the state planning budget 
get put together?
pol pot destroyed documents –
consequences still with us
49
New Possibilities for 
Massively Planned 
Social Action
50
Eric Whitacre’s Virtual Choir
Lux Aurumque (2010)
185 voices, 12 countries
51
Lux Aurumque
http://www.youtube.com/watch?v=D7o7BrlbaDs
• Eric Whitacre’s Virtual Choir 3.0, 3746 vidoes from 78 
countries
53
The meshing of actions of over 3000 
people in 78 different countries
• most of whom will never communicate with 
each other
54
55
56
US military operations center in Afghanistan
57
Warfighters’ Information Sharing Environment
Fire
Support
LogisticsAir Operations
Intelligence
Civil-Military
Operations
Targeting
Maneuver
&
Blue
Force
Tracking
e‐people (biology + Bildungskapital + 
intermeshing)
A new theory of personal identity:
You are a biological organism, with plans, skills, and a reputational trail
that is intermeshed digitally with the plans, skills and reputational trails 
of other human beings 
in such a way as to enable new sorts of human achievements in 
science, culture, commerce, law, war, …
Hernando de Soto
Institute for Liberty and Democracy, Lima, Peru
Bill Clinton: 
“The most promising anti‐poverty initiative in the world”
60
61
de Soto’s hypothesis
the development of civilization in the course 
of history goes hand in hand with the 
accumulation of documentation 
(property titles, registration of persons, 
professional qualifications, keeping of 
accounts ...)
62
The need for a trace
Civilization rests on complex social entities – claims, 
obligations, rights, powers, roles, offices
which survive for an extended period of time
What is the physical basis for this extended existence? 
Not the memories of those involved
–but permanent, re‐usable, discoverable records
These systems of records allowed new institutional 
artefacts such as mortgages and insurance to be 
created
and allowed human beings to acquire the habits and 
skills needed to participate successfully in the 
extended market order

Contenu connexe

Similaire à e‐Human Beings: The contribution of internet ranking systems to the development of human capital

Fuzzy Logic Based Recommender System
Fuzzy Logic Based Recommender SystemFuzzy Logic Based Recommender System
Fuzzy Logic Based Recommender SystemRSIS International
 
Overview of Recruitment Management Systems- Business.com
Overview of Recruitment Management Systems- Business.comOverview of Recruitment Management Systems- Business.com
Overview of Recruitment Management Systems- Business.comBusiness.com
 
AI Governance – The Responsible Use of AI
AI Governance – The Responsible Use of AIAI Governance – The Responsible Use of AI
AI Governance – The Responsible Use of AINUS-ISS
 
Faces in the Distorting Mirror: Revisiting Photo-based Social Authentication
Faces in the Distorting Mirror: Revisiting Photo-based Social AuthenticationFaces in the Distorting Mirror: Revisiting Photo-based Social Authentication
Faces in the Distorting Mirror: Revisiting Photo-based Social AuthenticationFACE
 
recruitment and selection in internet context.pdf
recruitment and selection in internet context.pdfrecruitment and selection in internet context.pdf
recruitment and selection in internet context.pdfshazia-ijaz
 
IRJET- Improving Performance of Fake Reviews Detection in Online Review’s usi...
IRJET- Improving Performance of Fake Reviews Detection in Online Review’s usi...IRJET- Improving Performance of Fake Reviews Detection in Online Review’s usi...
IRJET- Improving Performance of Fake Reviews Detection in Online Review’s usi...IRJET Journal
 
TRAIL Deck
TRAIL DeckTRAIL Deck
TRAIL DeckTRAIL
 
Recommendation Engines - An Architectural Guide
Recommendation Engines - An Architectural GuideRecommendation Engines - An Architectural Guide
Recommendation Engines - An Architectural GuideBigDataCloud
 
Unc cause 2010 Identity and Access Mgmt Panel
Unc cause 2010  Identity and Access Mgmt PanelUnc cause 2010  Identity and Access Mgmt Panel
Unc cause 2010 Identity and Access Mgmt PanelMark Scheible
 
Social Tagging Of Multimedia Content A Model
Social Tagging Of Multimedia Content A ModelSocial Tagging Of Multimedia Content A Model
Social Tagging Of Multimedia Content A ModelIJMER
 
3 Rules Behind The Most Successful Products - SC Moatti, Mighty Capital
3 Rules Behind The Most Successful Products - SC Moatti, Mighty Capital3 Rules Behind The Most Successful Products - SC Moatti, Mighty Capital
3 Rules Behind The Most Successful Products - SC Moatti, Mighty CapitalTraction Conf
 
"The 3 Rules Behind The Most Successful Products" by SC Moatti
"The 3 Rules Behind The Most Successful Products" by SC Moatti "The 3 Rules Behind The Most Successful Products" by SC Moatti
"The 3 Rules Behind The Most Successful Products" by SC Moatti Productized
 
12813 1 Copyright © 2011 Pearson Education, Inc. Al
12813 1 Copyright © 2011 Pearson Education, Inc.  Al12813 1 Copyright © 2011 Pearson Education, Inc.  Al
12813 1 Copyright © 2011 Pearson Education, Inc. Aldrennanmicah
 
12813 1 Copyright © 2011 Pearson Education, Inc. Al
12813 1 Copyright © 2011 Pearson Education, Inc.  Al12813 1 Copyright © 2011 Pearson Education, Inc.  Al
12813 1 Copyright © 2011 Pearson Education, Inc. Alalisondakintxt
 
12813 1 Copyright © 2011 Pearson Education, Inc. Al
12813 1 Copyright © 2011 Pearson Education, Inc.  Al12813 1 Copyright © 2011 Pearson Education, Inc.  Al
12813 1 Copyright © 2011 Pearson Education, Inc. Allauvicuna8dw
 
An Integrated E-Recruitment System For Automated Personality Mining And Appli...
An Integrated E-Recruitment System For Automated Personality Mining And Appli...An Integrated E-Recruitment System For Automated Personality Mining And Appli...
An Integrated E-Recruitment System For Automated Personality Mining And Appli...Fiona Phillips
 
Recommender System _Module 1_Introduction to Recommender System.pptx
Recommender System _Module 1_Introduction to Recommender System.pptxRecommender System _Module 1_Introduction to Recommender System.pptx
Recommender System _Module 1_Introduction to Recommender System.pptxSatyam Sharma
 
How Uber turbo-charged the Sharing Economy Business Model
How Uber turbo-charged the Sharing Economy Business ModelHow Uber turbo-charged the Sharing Economy Business Model
How Uber turbo-charged the Sharing Economy Business ModelMurat @ InnovationTactics.com
 

Similaire à e‐Human Beings: The contribution of internet ranking systems to the development of human capital (20)

Fuzzy Logic Based Recommender System
Fuzzy Logic Based Recommender SystemFuzzy Logic Based Recommender System
Fuzzy Logic Based Recommender System
 
Overview of Recruitment Management Systems- Business.com
Overview of Recruitment Management Systems- Business.comOverview of Recruitment Management Systems- Business.com
Overview of Recruitment Management Systems- Business.com
 
AI Governance – The Responsible Use of AI
AI Governance – The Responsible Use of AIAI Governance – The Responsible Use of AI
AI Governance – The Responsible Use of AI
 
Faces in the Distorting Mirror: Revisiting Photo-based Social Authentication
Faces in the Distorting Mirror: Revisiting Photo-based Social AuthenticationFaces in the Distorting Mirror: Revisiting Photo-based Social Authentication
Faces in the Distorting Mirror: Revisiting Photo-based Social Authentication
 
recruitment and selection in internet context.pdf
recruitment and selection in internet context.pdfrecruitment and selection in internet context.pdf
recruitment and selection in internet context.pdf
 
IRJET- Improving Performance of Fake Reviews Detection in Online Review’s usi...
IRJET- Improving Performance of Fake Reviews Detection in Online Review’s usi...IRJET- Improving Performance of Fake Reviews Detection in Online Review’s usi...
IRJET- Improving Performance of Fake Reviews Detection in Online Review’s usi...
 
TRAIL Deck
TRAIL DeckTRAIL Deck
TRAIL Deck
 
Hris
HrisHris
Hris
 
Recommendation Engines - An Architectural Guide
Recommendation Engines - An Architectural GuideRecommendation Engines - An Architectural Guide
Recommendation Engines - An Architectural Guide
 
Unc cause 2010 Identity and Access Mgmt Panel
Unc cause 2010  Identity and Access Mgmt PanelUnc cause 2010  Identity and Access Mgmt Panel
Unc cause 2010 Identity and Access Mgmt Panel
 
Social Tagging Of Multimedia Content A Model
Social Tagging Of Multimedia Content A ModelSocial Tagging Of Multimedia Content A Model
Social Tagging Of Multimedia Content A Model
 
3 Rules Behind The Most Successful Products - SC Moatti, Mighty Capital
3 Rules Behind The Most Successful Products - SC Moatti, Mighty Capital3 Rules Behind The Most Successful Products - SC Moatti, Mighty Capital
3 Rules Behind The Most Successful Products - SC Moatti, Mighty Capital
 
"The 3 Rules Behind The Most Successful Products" by SC Moatti
"The 3 Rules Behind The Most Successful Products" by SC Moatti "The 3 Rules Behind The Most Successful Products" by SC Moatti
"The 3 Rules Behind The Most Successful Products" by SC Moatti
 
12813 1 Copyright © 2011 Pearson Education, Inc. Al
12813 1 Copyright © 2011 Pearson Education, Inc.  Al12813 1 Copyright © 2011 Pearson Education, Inc.  Al
12813 1 Copyright © 2011 Pearson Education, Inc. Al
 
12813 1 Copyright © 2011 Pearson Education, Inc. Al
12813 1 Copyright © 2011 Pearson Education, Inc.  Al12813 1 Copyright © 2011 Pearson Education, Inc.  Al
12813 1 Copyright © 2011 Pearson Education, Inc. Al
 
12813 1 Copyright © 2011 Pearson Education, Inc. Al
12813 1 Copyright © 2011 Pearson Education, Inc.  Al12813 1 Copyright © 2011 Pearson Education, Inc.  Al
12813 1 Copyright © 2011 Pearson Education, Inc. Al
 
An Integrated E-Recruitment System For Automated Personality Mining And Appli...
An Integrated E-Recruitment System For Automated Personality Mining And Appli...An Integrated E-Recruitment System For Automated Personality Mining And Appli...
An Integrated E-Recruitment System For Automated Personality Mining And Appli...
 
Recommender System _Module 1_Introduction to Recommender System.pptx
Recommender System _Module 1_Introduction to Recommender System.pptxRecommender System _Module 1_Introduction to Recommender System.pptx
Recommender System _Module 1_Introduction to Recommender System.pptx
 
Digital Ethics
Digital EthicsDigital Ethics
Digital Ethics
 
How Uber turbo-charged the Sharing Economy Business Model
How Uber turbo-charged the Sharing Economy Business ModelHow Uber turbo-charged the Sharing Economy Business Model
How Uber turbo-charged the Sharing Economy Business Model
 

Plus de Barry Smith

Towards an Ontology of Philosophy
Towards an Ontology of PhilosophyTowards an Ontology of Philosophy
Towards an Ontology of PhilosophyBarry Smith
 
An application of Basic Formal Ontology to the Ontology of Services and Commo...
An application of Basic Formal Ontology to the Ontology of Services and Commo...An application of Basic Formal Ontology to the Ontology of Services and Commo...
An application of Basic Formal Ontology to the Ontology of Services and Commo...Barry Smith
 
Ways of Worldmarking: The Ontology of the Eruv
Ways of Worldmarking: The Ontology of the EruvWays of Worldmarking: The Ontology of the Eruv
Ways of Worldmarking: The Ontology of the EruvBarry Smith
 
The Division of Deontic Labor
The Division of Deontic LaborThe Division of Deontic Labor
The Division of Deontic LaborBarry Smith
 
Ontology of Aging (August 2014)
Ontology of Aging (August 2014)Ontology of Aging (August 2014)
Ontology of Aging (August 2014)Barry Smith
 
The Fifth Cycle of Philosophy
The Fifth Cycle of PhilosophyThe Fifth Cycle of Philosophy
The Fifth Cycle of PhilosophyBarry Smith
 
Ontology of Poker
Ontology of PokerOntology of Poker
Ontology of PokerBarry Smith
 
Clinical trial data wants to be free: Lessons from the ImmPort Immunology Dat...
Clinical trial data wants to be free: Lessons from the ImmPort Immunology Dat...Clinical trial data wants to be free: Lessons from the ImmPort Immunology Dat...
Clinical trial data wants to be free: Lessons from the ImmPort Immunology Dat...Barry Smith
 
Enhancing the Quality of ImmPort Data
Enhancing the Quality of ImmPort DataEnhancing the Quality of ImmPort Data
Enhancing the Quality of ImmPort DataBarry Smith
 
The Philosophome: An Exercise in the Ontology of the Humanities
The Philosophome: An Exercise in the Ontology of the HumanitiesThe Philosophome: An Exercise in the Ontology of the Humanities
The Philosophome: An Exercise in the Ontology of the HumanitiesBarry Smith
 
IAO-Intel: An Ontology of Information Artifacts in the Intelligence Domain
IAO-Intel: An Ontology of Information Artifacts in the Intelligence DomainIAO-Intel: An Ontology of Information Artifacts in the Intelligence Domain
IAO-Intel: An Ontology of Information Artifacts in the Intelligence DomainBarry Smith
 
Science of Emerging Social Media
Science of Emerging Social MediaScience of Emerging Social Media
Science of Emerging Social MediaBarry Smith
 
Ethics, Informatics and Obamacare
Ethics, Informatics and ObamacareEthics, Informatics and Obamacare
Ethics, Informatics and ObamacareBarry Smith
 
Ontology of aging and death
Ontology of aging and deathOntology of aging and death
Ontology of aging and deathBarry Smith
 
Ontology in-buffalo-2013
Ontology in-buffalo-2013Ontology in-buffalo-2013
Ontology in-buffalo-2013Barry Smith
 
ImmPort strategies to enhance discoverability of clinical trial data
ImmPort strategies to enhance discoverability of clinical trial dataImmPort strategies to enhance discoverability of clinical trial data
ImmPort strategies to enhance discoverability of clinical trial dataBarry Smith
 
Ontology of Documents (2005)
Ontology of Documents (2005)Ontology of Documents (2005)
Ontology of Documents (2005)Barry Smith
 
Ontology and the National Cancer Institute Thesaurus (2005)
Ontology and the National Cancer Institute Thesaurus (2005)Ontology and the National Cancer Institute Thesaurus (2005)
Ontology and the National Cancer Institute Thesaurus (2005)Barry Smith
 
Introduction to the Logic of Definitions
Introduction to the Logic of DefinitionsIntroduction to the Logic of Definitions
Introduction to the Logic of DefinitionsBarry Smith
 

Plus de Barry Smith (20)

Towards an Ontology of Philosophy
Towards an Ontology of PhilosophyTowards an Ontology of Philosophy
Towards an Ontology of Philosophy
 
An application of Basic Formal Ontology to the Ontology of Services and Commo...
An application of Basic Formal Ontology to the Ontology of Services and Commo...An application of Basic Formal Ontology to the Ontology of Services and Commo...
An application of Basic Formal Ontology to the Ontology of Services and Commo...
 
Ways of Worldmarking: The Ontology of the Eruv
Ways of Worldmarking: The Ontology of the EruvWays of Worldmarking: The Ontology of the Eruv
Ways of Worldmarking: The Ontology of the Eruv
 
The Division of Deontic Labor
The Division of Deontic LaborThe Division of Deontic Labor
The Division of Deontic Labor
 
Ontology of Aging (August 2014)
Ontology of Aging (August 2014)Ontology of Aging (August 2014)
Ontology of Aging (August 2014)
 
Meaningful Use
Meaningful UseMeaningful Use
Meaningful Use
 
The Fifth Cycle of Philosophy
The Fifth Cycle of PhilosophyThe Fifth Cycle of Philosophy
The Fifth Cycle of Philosophy
 
Ontology of Poker
Ontology of PokerOntology of Poker
Ontology of Poker
 
Clinical trial data wants to be free: Lessons from the ImmPort Immunology Dat...
Clinical trial data wants to be free: Lessons from the ImmPort Immunology Dat...Clinical trial data wants to be free: Lessons from the ImmPort Immunology Dat...
Clinical trial data wants to be free: Lessons from the ImmPort Immunology Dat...
 
Enhancing the Quality of ImmPort Data
Enhancing the Quality of ImmPort DataEnhancing the Quality of ImmPort Data
Enhancing the Quality of ImmPort Data
 
The Philosophome: An Exercise in the Ontology of the Humanities
The Philosophome: An Exercise in the Ontology of the HumanitiesThe Philosophome: An Exercise in the Ontology of the Humanities
The Philosophome: An Exercise in the Ontology of the Humanities
 
IAO-Intel: An Ontology of Information Artifacts in the Intelligence Domain
IAO-Intel: An Ontology of Information Artifacts in the Intelligence DomainIAO-Intel: An Ontology of Information Artifacts in the Intelligence Domain
IAO-Intel: An Ontology of Information Artifacts in the Intelligence Domain
 
Science of Emerging Social Media
Science of Emerging Social MediaScience of Emerging Social Media
Science of Emerging Social Media
 
Ethics, Informatics and Obamacare
Ethics, Informatics and ObamacareEthics, Informatics and Obamacare
Ethics, Informatics and Obamacare
 
Ontology of aging and death
Ontology of aging and deathOntology of aging and death
Ontology of aging and death
 
Ontology in-buffalo-2013
Ontology in-buffalo-2013Ontology in-buffalo-2013
Ontology in-buffalo-2013
 
ImmPort strategies to enhance discoverability of clinical trial data
ImmPort strategies to enhance discoverability of clinical trial dataImmPort strategies to enhance discoverability of clinical trial data
ImmPort strategies to enhance discoverability of clinical trial data
 
Ontology of Documents (2005)
Ontology of Documents (2005)Ontology of Documents (2005)
Ontology of Documents (2005)
 
Ontology and the National Cancer Institute Thesaurus (2005)
Ontology and the National Cancer Institute Thesaurus (2005)Ontology and the National Cancer Institute Thesaurus (2005)
Ontology and the National Cancer Institute Thesaurus (2005)
 
Introduction to the Logic of Definitions
Introduction to the Logic of DefinitionsIntroduction to the Logic of Definitions
Introduction to the Logic of Definitions
 

Dernier

Micro-Scholarship, What it is, How can it help me.pdf
Micro-Scholarship, What it is, How can it help me.pdfMicro-Scholarship, What it is, How can it help me.pdf
Micro-Scholarship, What it is, How can it help me.pdfPoh-Sun Goh
 
How to Manage Global Discount in Odoo 17 POS
How to Manage Global Discount in Odoo 17 POSHow to Manage Global Discount in Odoo 17 POS
How to Manage Global Discount in Odoo 17 POSCeline George
 
Basic Civil Engineering first year Notes- Chapter 4 Building.pptx
Basic Civil Engineering first year Notes- Chapter 4 Building.pptxBasic Civil Engineering first year Notes- Chapter 4 Building.pptx
Basic Civil Engineering first year Notes- Chapter 4 Building.pptxDenish Jangid
 
Interdisciplinary_Insights_Data_Collection_Methods.pptx
Interdisciplinary_Insights_Data_Collection_Methods.pptxInterdisciplinary_Insights_Data_Collection_Methods.pptx
Interdisciplinary_Insights_Data_Collection_Methods.pptxPooja Bhuva
 
The basics of sentences session 3pptx.pptx
The basics of sentences session 3pptx.pptxThe basics of sentences session 3pptx.pptx
The basics of sentences session 3pptx.pptxheathfieldcps1
 
NO1 Top Black Magic Specialist In Lahore Black magic In Pakistan Kala Ilam Ex...
NO1 Top Black Magic Specialist In Lahore Black magic In Pakistan Kala Ilam Ex...NO1 Top Black Magic Specialist In Lahore Black magic In Pakistan Kala Ilam Ex...
NO1 Top Black Magic Specialist In Lahore Black magic In Pakistan Kala Ilam Ex...Amil baba
 
On National Teacher Day, meet the 2024-25 Kenan Fellows
On National Teacher Day, meet the 2024-25 Kenan FellowsOn National Teacher Day, meet the 2024-25 Kenan Fellows
On National Teacher Day, meet the 2024-25 Kenan FellowsMebane Rash
 
Accessible Digital Futures project (20/03/2024)
Accessible Digital Futures project (20/03/2024)Accessible Digital Futures project (20/03/2024)
Accessible Digital Futures project (20/03/2024)Jisc
 
SOC 101 Demonstration of Learning Presentation
SOC 101 Demonstration of Learning PresentationSOC 101 Demonstration of Learning Presentation
SOC 101 Demonstration of Learning Presentationcamerronhm
 
UGC NET Paper 1 Mathematical Reasoning & Aptitude.pdf
UGC NET Paper 1 Mathematical Reasoning & Aptitude.pdfUGC NET Paper 1 Mathematical Reasoning & Aptitude.pdf
UGC NET Paper 1 Mathematical Reasoning & Aptitude.pdfNirmal Dwivedi
 
How to Add New Custom Addons Path in Odoo 17
How to Add New Custom Addons Path in Odoo 17How to Add New Custom Addons Path in Odoo 17
How to Add New Custom Addons Path in Odoo 17Celine George
 
HMCS Max Bernays Pre-Deployment Brief (May 2024).pptx
HMCS Max Bernays Pre-Deployment Brief (May 2024).pptxHMCS Max Bernays Pre-Deployment Brief (May 2024).pptx
HMCS Max Bernays Pre-Deployment Brief (May 2024).pptxEsquimalt MFRC
 
Unit 3 Emotional Intelligence and Spiritual Intelligence.pdf
Unit 3 Emotional Intelligence and Spiritual Intelligence.pdfUnit 3 Emotional Intelligence and Spiritual Intelligence.pdf
Unit 3 Emotional Intelligence and Spiritual Intelligence.pdfDr Vijay Vishwakarma
 
Fostering Friendships - Enhancing Social Bonds in the Classroom
Fostering Friendships - Enhancing Social Bonds  in the ClassroomFostering Friendships - Enhancing Social Bonds  in the Classroom
Fostering Friendships - Enhancing Social Bonds in the ClassroomPooky Knightsmith
 
On_Translating_a_Tamil_Poem_by_A_K_Ramanujan.pptx
On_Translating_a_Tamil_Poem_by_A_K_Ramanujan.pptxOn_Translating_a_Tamil_Poem_by_A_K_Ramanujan.pptx
On_Translating_a_Tamil_Poem_by_A_K_Ramanujan.pptxPooja Bhuva
 
How to Give a Domain for a Field in Odoo 17
How to Give a Domain for a Field in Odoo 17How to Give a Domain for a Field in Odoo 17
How to Give a Domain for a Field in Odoo 17Celine George
 
Key note speaker Neum_Admir Softic_ENG.pdf
Key note speaker Neum_Admir Softic_ENG.pdfKey note speaker Neum_Admir Softic_ENG.pdf
Key note speaker Neum_Admir Softic_ENG.pdfAdmir Softic
 
Single or Multiple melodic lines structure
Single or Multiple melodic lines structureSingle or Multiple melodic lines structure
Single or Multiple melodic lines structuredhanjurrannsibayan2
 
Plant propagation: Sexual and Asexual propapagation.pptx
Plant propagation: Sexual and Asexual propapagation.pptxPlant propagation: Sexual and Asexual propapagation.pptx
Plant propagation: Sexual and Asexual propapagation.pptxUmeshTimilsina1
 
Food safety_Challenges food safety laboratories_.pdf
Food safety_Challenges food safety laboratories_.pdfFood safety_Challenges food safety laboratories_.pdf
Food safety_Challenges food safety laboratories_.pdfSherif Taha
 

Dernier (20)

Micro-Scholarship, What it is, How can it help me.pdf
Micro-Scholarship, What it is, How can it help me.pdfMicro-Scholarship, What it is, How can it help me.pdf
Micro-Scholarship, What it is, How can it help me.pdf
 
How to Manage Global Discount in Odoo 17 POS
How to Manage Global Discount in Odoo 17 POSHow to Manage Global Discount in Odoo 17 POS
How to Manage Global Discount in Odoo 17 POS
 
Basic Civil Engineering first year Notes- Chapter 4 Building.pptx
Basic Civil Engineering first year Notes- Chapter 4 Building.pptxBasic Civil Engineering first year Notes- Chapter 4 Building.pptx
Basic Civil Engineering first year Notes- Chapter 4 Building.pptx
 
Interdisciplinary_Insights_Data_Collection_Methods.pptx
Interdisciplinary_Insights_Data_Collection_Methods.pptxInterdisciplinary_Insights_Data_Collection_Methods.pptx
Interdisciplinary_Insights_Data_Collection_Methods.pptx
 
The basics of sentences session 3pptx.pptx
The basics of sentences session 3pptx.pptxThe basics of sentences session 3pptx.pptx
The basics of sentences session 3pptx.pptx
 
NO1 Top Black Magic Specialist In Lahore Black magic In Pakistan Kala Ilam Ex...
NO1 Top Black Magic Specialist In Lahore Black magic In Pakistan Kala Ilam Ex...NO1 Top Black Magic Specialist In Lahore Black magic In Pakistan Kala Ilam Ex...
NO1 Top Black Magic Specialist In Lahore Black magic In Pakistan Kala Ilam Ex...
 
On National Teacher Day, meet the 2024-25 Kenan Fellows
On National Teacher Day, meet the 2024-25 Kenan FellowsOn National Teacher Day, meet the 2024-25 Kenan Fellows
On National Teacher Day, meet the 2024-25 Kenan Fellows
 
Accessible Digital Futures project (20/03/2024)
Accessible Digital Futures project (20/03/2024)Accessible Digital Futures project (20/03/2024)
Accessible Digital Futures project (20/03/2024)
 
SOC 101 Demonstration of Learning Presentation
SOC 101 Demonstration of Learning PresentationSOC 101 Demonstration of Learning Presentation
SOC 101 Demonstration of Learning Presentation
 
UGC NET Paper 1 Mathematical Reasoning & Aptitude.pdf
UGC NET Paper 1 Mathematical Reasoning & Aptitude.pdfUGC NET Paper 1 Mathematical Reasoning & Aptitude.pdf
UGC NET Paper 1 Mathematical Reasoning & Aptitude.pdf
 
How to Add New Custom Addons Path in Odoo 17
How to Add New Custom Addons Path in Odoo 17How to Add New Custom Addons Path in Odoo 17
How to Add New Custom Addons Path in Odoo 17
 
HMCS Max Bernays Pre-Deployment Brief (May 2024).pptx
HMCS Max Bernays Pre-Deployment Brief (May 2024).pptxHMCS Max Bernays Pre-Deployment Brief (May 2024).pptx
HMCS Max Bernays Pre-Deployment Brief (May 2024).pptx
 
Unit 3 Emotional Intelligence and Spiritual Intelligence.pdf
Unit 3 Emotional Intelligence and Spiritual Intelligence.pdfUnit 3 Emotional Intelligence and Spiritual Intelligence.pdf
Unit 3 Emotional Intelligence and Spiritual Intelligence.pdf
 
Fostering Friendships - Enhancing Social Bonds in the Classroom
Fostering Friendships - Enhancing Social Bonds  in the ClassroomFostering Friendships - Enhancing Social Bonds  in the Classroom
Fostering Friendships - Enhancing Social Bonds in the Classroom
 
On_Translating_a_Tamil_Poem_by_A_K_Ramanujan.pptx
On_Translating_a_Tamil_Poem_by_A_K_Ramanujan.pptxOn_Translating_a_Tamil_Poem_by_A_K_Ramanujan.pptx
On_Translating_a_Tamil_Poem_by_A_K_Ramanujan.pptx
 
How to Give a Domain for a Field in Odoo 17
How to Give a Domain for a Field in Odoo 17How to Give a Domain for a Field in Odoo 17
How to Give a Domain for a Field in Odoo 17
 
Key note speaker Neum_Admir Softic_ENG.pdf
Key note speaker Neum_Admir Softic_ENG.pdfKey note speaker Neum_Admir Softic_ENG.pdf
Key note speaker Neum_Admir Softic_ENG.pdf
 
Single or Multiple melodic lines structure
Single or Multiple melodic lines structureSingle or Multiple melodic lines structure
Single or Multiple melodic lines structure
 
Plant propagation: Sexual and Asexual propapagation.pptx
Plant propagation: Sexual and Asexual propapagation.pptxPlant propagation: Sexual and Asexual propapagation.pptx
Plant propagation: Sexual and Asexual propapagation.pptx
 
Food safety_Challenges food safety laboratories_.pdf
Food safety_Challenges food safety laboratories_.pdfFood safety_Challenges food safety laboratories_.pdf
Food safety_Challenges food safety laboratories_.pdf
 

e‐Human Beings: The contribution of internet ranking systems to the development of human capital