SlideShare une entreprise Scribd logo
1  sur  7
Télécharger pour lire hors ligne
 
	
  
# Web Apollo Workshop - Exercises
# At Kansas State University
# 17 June, 2015
# M. Munoz-Torres
# Berkeley Bioinformatics Open Source Projects
# Lawrence Berkeley National Laboratory
-----------------------------------------------------------------------
# Web Apollo Workshop - KSU
# Exercise 1
It has come to our attention that the Apis mellifera (honey bee) ortholog of Nesprin-1 (nuclear
envelope spectrin repeat proteins) or Muscle specific protein 300 is fragmented into possibly 5
different genes in the current gene set.
In Drosophila melanogaster MSP-300 anchors nuclei to actin, and has been reported to be
essential for positioning of nurse cell nuclei during oogenesis, and thus production of mature
ooctyes. More information available at http://en.wikipedia.org/wiki/Nesprin
You may use this fragment from the Megachile rotundata (the alfalfa leafcutter bee) model (NCBI
identifier XP_003705060.1; at http://www.ncbi.nlm.nih.gov/) to pull the corresponding location in
Apis mellifera using BLAT. The protein has over 12K amino acid residues in M. rotundata.
>M_rotundata nesprin-1-like (fragment)
MRIVEGRYSGSGGYWNVTILEGGDTGTWGYQKVGILERGGTRRWGYWNVGVPEGGDTGTWGYQKVGILER
GGTRRWGYWNVGVPEGGDTGTWGYQKVGILERGGTRRWGYWNVGVPEGGDTGTWGDSGAWGYWNVRILEG
GDTGTWRYQKVWSGGRTASSEELFQELDGRRNVGHFRSPTNPRPSSRASDSSFEESFERLVEEGELNGAK
VVKFEKITVRKSVREVAGTGVSHQRVLAETSRTPSEEHALEDSAYQSHSHGAPSHGSKSSSVTSFTRFPS
EESLSQRRGSSPQQHLGPDDRTPSEWYAEYHTQSFQNVAARIEYVRSKSEYDAHIAEIKDEQERVQKKTF
VNWINSYLSKRIPPLRVDDLIDDLKDGTRLLALLEVLSGEKLPVERGRNLKRPHFLSNANTALQFLQS
Gene models GB40006-RA and GB40007-RA have significant sequence similarity with this gene
model.
Using the entire M. rotundata model, shows high-scoring segment pairs (hsp) across GB40006-
RA, GB40007-RA, GB40008-RA, GB40009-RA, and GB40010-RA.
Clear highlight.
Drag and merge GB40006-RA, GB40007-RA, and GB40008-RA
Rename transcript to: nesprin-1-like-RA
Observing Nurse RNA-seq reads, there are no reads in support of the exon at 483,800 - 483,705,
while there are many reads in support of an intron passing across the region. Delete the exon (#1
of GB40007-RA).
Closer inspection of RNA-seq reads also reveals that there are many reads in support of NOT
having an exon in coordinates 494,235 - 491,660. Delete exon (#2 of GB40006-RA).
It is now time to inspect the adjacent exons at the merging of GB40007-RA and GB40008-RA.
Guided by RNA-seq reads (their length, not their exact coordinates), the phase and the structure
of all exons downstream (3') of 454,041 (… 453,654), you may adjust the coordinates for the
adjacent exons in this region, so they may have canonical splice sites.
Monica Munoz-Torres, PhD
Lead Biocurator | Bioinformatics Analyst
Lawrence Berkeley National Laboratory
Joint Genome Institute for the US Department of Energy
2800 Mitchell Dr. Ste 100. Walnut Creek, CA 94598
mcmunozt@lbl.gov | @monimunozto | (925) 296-5624
 
	
  
First, the last exon of GB40007-RA can be adjusted to the nearest canonical splice, located 5' in
position 454,041.
There is a gap between 453,759 .. 453,710.
The first exon of GB40008-RA should also be adjusted to the nearest canonical site that extends
the protein and is supported by RNA-seq reads. After trying a few sites, position 453,659 is a
canonical splice site that conserves the phase of the rest of the product and matches the
boundaries of RNAseq reads (-2 -- f 1,2,3).
There are many exons in this model; compared to the previous bee model for A. mellifera (in
NCBI), there is an excess of about 20 exons. This newly created gene product is 7,600 amino
acids in length. Use this product to query NCBI's nr for orthologs, using BLAST at
http://blast.ncbi.nlm.nih.gov/Blast.cgi
The search retrieves homologs from other Apidae (A. dorsata, A. florea, N. vitripennis, B.
impatiens) of similar length --> ~39Kbp, 12K aa.
Modify the exon coordinates at the flagged non-canonical sites at the junctions of gene models
using RNAseq to guide the changes and use "color by CDS" feature to preserve the phase.
RNA-seq shows that the last exon in GB40008-RA may not be real (or perhaps, it is possible that
there are more than one isoform (at 431,750)). There are 11 isoforms in D. melanogaster.
With RNA-seq evidence as support, use Apollo’s 'edge-matching' functionality to modify the 5'
end of the first exon of GB40009-RA to match the boundary of transcripts from 431,668 to that
matching RNAseq evidence at 431,683 (choose exon and RNA-seq read, right-click, 'set as 5'
end'). Remember: only those reads oriented in the same sense as the transcription will work with
the ‘set as x’ end’ operation.
Name this isoform (RA) and create a copy using the option "Duplicate" from the right-click menu.
In the second isoform (RB), delete exon at ~431,750 (last exon of GB40008-RA) to reveal that
the phase in the rest of the peptide is restored to that of original gene model. Copy the 9009 aa
residues and query the public databases again using BLAST at NCBI.
Merge the model with GB40010-RA, rename to reflect that this is isoform B.
At the junction, follow RNA-seq reads pattern to adjust the last exon of GB40009-RA to canonical
splice site at 427,372, and the first exon of GB40010-RA to canonical splice site at 427,069
immediately 3' of the GAP and the longest extension supported by RNA-seq data.
You may also use additional evidence tracks to support these decisions: e.g. Forager Illumina
Bee Contigs, Mixed Antennae 454 Contigs, and Fgenesh++ with RNAseq training data.
In this peptide, at position 394,197 a GC splice donor (common in insects) is visible and heavily
supported by the evidence. (GC/AG instead of GT/AG). Note on the comments and finish the
annotation.
A final product of 16,509aa in length is obtained.
Check integrity and accuracy:
- blastp vs Insecta (at NCBI) (-Apis mellifera ; i.e. without honey bee)
- add GO terms (from Drosophila entries - PAINT)
- search the literature to add PubMed IDs (http://www.ncbi.nlm.nih.gov/pubmed).
 
	
  
-----------------------------------------------------------------------
# Web Apollo Workshop - KSU
# Exercise 2
It has come to our attention that the honey bee ortholog of small ribonucleoprotein particle protein
SmD2 is fragmented into 2 or more genes in the current gene set.
In Drosophila melanogaster SmD2 are involved in mRNA splicing, via spliceosome.
You may use the Apis florea model (XP_003697276.1) to pull the corresponding location in Apis
mellifera using BLAT.
>A_florea Sm D2-like
MLNNIRNITYFSDQSSLTKPKSEMTPEELAKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVK
AFDRHCNMVLENVKEMWTELPRTGKGKKKAKPVNKDRFISKMFLRGDSVILVLRNPLATASGK
Drag the honey bee gene model you found into the 'User-created Annotation Area' and retrieve
its sequence to query the public databases with it to inspect their structure. Query NCBI's nr for
orthologs, using BLAST at http://blast.ncbi.nlm.nih.gov/Blast.cgi
Review conserved domains, compare the alignments with other sequences and inspect their
length differences.
Find evidence in support of this model looking through the transcriptomes of Forager bees and
Nurse bees as well as available ESTs. For now, please refrain from using previous bee gene
models.
RNA-seq evidence will support current exons, as well as an additional exon in the 5'end.
Check integrity and accuracy:
- blastp vs Insecta (at NCBI) (-Apis mellifera)
- add GO terms (e.g. from Drosophila entries)
- search the literature to add PubMed IDs (http://www.ncbi.nlm.nih.gov/pubmed).
After checking the current protein product vs public databases, alignments will show a
discrepancy in the 5'end.
Can you spot the difference?
Are you able to find the missing residues in the current A. mellifera genome assembly?
Is there enough evidence to support this hypothesis?
How many isoforms would you annotate in this case?
 
	
  
-----------------------------------------------------------------------
# Web Apollo Workshop - KSU
# Exercise 3
It has come to our attention that the honey bee ortholog of FlyBase model CG31619 is
fragmented into 2 or more genes in the current gene set.
In Drosophila melanogaster CG31619 is involved in proteolysis, and has metalloendopeptidase
activity (molecular function).
We know that the homolog of CG31619 in Apis dorsata is similar to the ADAMTS proteins.
ADAMTS = A Disintegrin And Metalloproteinase with Thrombospondin Motifs, which is a family of
peptidases.
You may use the Apis dorsata model (XP_003697278.1) to pull the corresponding location in
Apis mellifera using BLAT in Apollo.
>Apis_dorsata ADAMTS-like protein partial
RENPRYWLQPCENPSDFRSEQCAAFDDVPYSGQLLKWYPHYDPSRPCALICRGEQSVENTGNRLRQE
TSVEKTLPHDATDALQLDSEETIVVQLADKVEDGTKCYTDSMDVCINGECMKVGCDLRVGSNKNTDPCGV
CGGNGSSCQSRYSWSLESISACSKSCGGGFKIAMAVCKAIGPDESVVDDSYCDPDNRPEKTLMPCNTHPC
Drag each of the honey bee gene models you found into the 'User-created Annotation Area' and
retrieve their sequences to query the public databases with them to inspect their structure. Query
NCBI's nr database for orthologs, using BLAST at http://blast.ncbi.nlm.nih.gov/Blast.cgi
Review conserved domains, compare the alignments with other sequences and inspect their
length differences.
Once you inspect the expected conserved domains, it will be apparent that the models need to be
brought together. Find evidence in support of this operation looking through the transcriptomes of
Forager bees and Nurse bees as well as available ESTs. For now, please refrain from using
previous bee gene models. The available evidence will show support of splice site corrections
and possible excess of exons.
Once you are satisfied with a final model, check integrity and accuracy:
- blastp vs Insecta (at NCBI) (-Apis mellifera)
- add GO terms (e.g from Drosophila entries)
- search the literature to add PubMed IDs (http://www.ncbi.nlm.nih.gov/pubmed).
 
	
  
-----------------------------------------------------------------------
# Web Apollo Workshop – KSU
# Exercise 4
It has come to our attention that the honey bee ortholog of RNA Polymerase II 140 KD is
fragmented into 2 or more genes in the current gene set.
In Drosophila melanogaster RNA Pol II is involved in transcription from RNA polymerase II
promoter and has DNA binding and DNA-directed RNA polymerase activity (molecular functions).
You may use the Apis dorsata model (XP_006610182.1) to pull the corresponding location in
Apis mellifera using BLAT in Apollo.
>Apis_dorsata RNA pol II subunit RPB2-like partial
MYSLEEDQYDDEDAEEISSKLWQEACWIVINAYFDEKGLVRQQLDSFDEFIEMSVQRIVEDSPQIDLQAE
AQHTSGEIENPVRHLLKFEQIYLSKPTHWEKDGAPSPMMPNEARLRNLTYSAPLYVDITKTIVKDGEDPI
ETQHQKTFIGKIPIMLRSKYCLLAGLSDRDLTELNECPLDPG
Drag each of the honey bee gene models you found into the 'User-created Annotation Area' and
retrieve their sequences to query the public databases with them to inspect their structure. Query
NCBI's nr for orthologs, using BLAST at http://blast.ncbi.nlm.nih.gov/Blast.cgi
Check to notice the conserved domains -- are they intact in each model?
Will bringing these models together improve the integrity of the RNA Pol II subunit RPB2 homolog
in honey bee?
Re-arrange the boundaries at the joining region to be canonical splice sites on each side.
Did you spot the sequence error visible in the DNA-Track? What effect do you think this had on
the automated annotation process?
Once you are satisfied with a final model, check integrity and accuracy:
- blastp vs Insecta (at NCBI) (-Apis mellifera)
- add GO terms (e.g. from Drosophila entries)
- search the literature to add PubMed IDs (http://www.ncbi.nlm.nih.gov/pubmed).
 
	
  
-----------------------------------------------------------------------
# Web Apollo Workshop - KSU
# Exercise 5
It has come to our attention that the honey bee ortholog of Ceramidase is fragmented into 2 or
more genes in the current gene set.
Ceramidase is an enzyme, which cleaves fatty acids from ceramide, producing sphingosine
(SPH) which in turn is phosphorylated by a sphingosine kinase to form sphingosine-1-phosphate
(S1P). Ceramide, SPH, and S1P are bioactive lipids that mediate cell proliferation, differentiation,
apoptosis, adhesion, and migration.
You may use the Bombus terrestris model (XP_003397164.1) to pull the corresponding location
in Apis mellifera using BLAT. The following is a fragment.
>B_terrestris Ceramidase-like
GTTTAAGAGTGTTCGCGCCAATTGTTCGCGGCGAGACTGGCCGTGCAGACCAGCTGTTATAGCCGCGTCT
CCGCTCTGTCTCTGCTGATCCATCGATCACCTACGCATCGATCCCTCGTTCGATCAACGTGGTCATGAGC
TGGAGCGTTTGAGCGCCGCTATCAGACTGGCGGCAGAGAAAAACTGAATGGAGGCACCGGCAGTTGGACG
CTTTAGAATCCTTGCGTTGTTGACGATATGGCTGGTCCAGCTTGCGGTGCCCGGCGCCATCGCGTCTTAC
AGCATCGGGGTGGGCAGAGCAGATGCTACAGGACCCGCCGCTGAAATTGTTTTTATGGGCTACGCGAAGA
TCGATCAAAAAGGATCAGGAATCCATCTTCGAACATTCTCCCGCGCATTCATCATCGACGATGGCGAGGA
GAGGTTCGTCTTCGTCAGCGTGGATAGCGCCATGATAGGAAACGGCGTTCGTCAAACGGTGTTGCAGAAT
CTTGAAAAGGAGTTTGGCAGCCTGTACACAGAGAAAAATGTGATGATCAGTGCAACTCACTCGCACTCCA
CACCCGGTGGATTCATGTTGCACATGTTGTTCGATATTACGACATTCGGTTTCGTTCAAGAGACCTTCGA
TGCTATGGTCAAGGGAATCACGAAGAGTATTCAACGTGCTCACTATGCCATAGTTCCAGGCAGAATATTC
ATCACCCATGGAGAAGTTCATGGTGTGAACATTAATAGAAGCCCATCCG
Drag the honey bee gene model(s) you found into the 'User-created Annotation Area' and retrieve
its sequence(s) to query the public databases to inspect its/their structure. Query NCBI's nr for
orthologs, using BLAST at http://blast.ncbi.nlm.nih.gov/Blast.cgi
Check to notice the conserved domains, if any. And if so, are they intact in each model?
After inspecting the biological evidence in the area, do you think these models should be brought
together? If so, how?
Are you able to establish whether you should annotate UTRs to this gene model hypothesis?
Once you are satisfied with a final model, check integrity and accuracy:
- blastp vs Insecta (at NCBI) (-Apis mellifera)
- add GO terms (e.g. from Drosophila entries)
- search the literature to add PubMed IDs (http://www.ncbi.nlm.nih.gov/pubmed).
 
	
  
-----------------------------------------------------------------------
# Web Apollo Workshop - KSU
# Exercise 6
It has come to our attention that the honey bee ortholog of adenomatous polyposis coli (APC) -
like is fragmented into possibly 4 or more genes in the current gene set.
In Drosophila melanogaster adenomatous polyposis coli (APC) -like is involved in beta-catenin
binding and microtubule binding.
APC is a negative regulator that controls Beta-catenin concentrations and interacts with E-
cadherin, which are involved in cell adhesion. APC is classified as a tumor suppressor gene.
Mutations in the APC gene may result in colorectal cancer.
You may use the Camponotus floridanus gene model (EFN68235.1) to pull the corresponding
location in Apis mellifera using BLAT. The following is a fragment.
>Camponotus floridanus APC-like partial
GRVLCGSAASVGVEGVGGAWGAQRRQSPPPLASRRLESAADAVVAAAAAAAVATTAASFNPVTQRCAKKG
AVDAVAPRRIYPGPPLVAETSKEDAMEPEAKEEDERRSSTPSPEFYLRRSKRYNEDGSSEEETKQDSISL
PNHRLPSSYRGTWPIRRDVWANQQIGFPAQQSTSLAAHNDVASVMSFSSSSNSAGLDSHSVELQGHRRLG
AKVDVVYNLLGMLEKNGRDDMSTTLLSMSTSLDSCLVMRQSGCLPLLVQLIHAPRQDPDTRDRAMQALHN
VVHAKSDERAGRREARVLRFLEQLRDYCQSLRMSLERGQSMDDLERGHPAATIAALMKLSFDEAHRHAMC
QLGGLHAVAELIEMDHLAHGSESDDQNCITLRRYAGMALTNLTFGDGNNKALLCSFKEFMKALVSQLKSP
SDDLRQVTASVLRNLSWRADSSSKQTLREVGAVTGLMKAAMEGRKESTLKSILSALWNLSAHCSTNKVDI
Check to notice the conserved domains, if any. And if so, are they intact in each model?
After inspecting the biological evidence in the area, do you think these models should be brought
together? if so, how?
Once you are satisfied with a final model, check integrity and accuracy:
- blastp vs Insecta (at NCBI) (-Apis mellifera)
- add GO terms (e.g. from Drosophila entries)
- search the literature to add PubMed IDs (http://www.ncbi.nlm.nih.gov/pubmed).

Contenu connexe

Tendances

Differential gene expression
Differential gene expressionDifferential gene expression
Differential gene expressionDenis C. Bauer
 
Targeted Breeding Applications of CRISPR-Cas
Targeted Breeding Applications of CRISPR-CasTargeted Breeding Applications of CRISPR-Cas
Targeted Breeding Applications of CRISPR-CasKate Barlow
 
NCBI Boot Camp for Beginners Slides
NCBI Boot Camp for Beginners SlidesNCBI Boot Camp for Beginners Slides
NCBI Boot Camp for Beginners SlidesJackie Wirz, PhD
 
Genome Assembly: the art of trying to make one BIG thing from millions of ver...
Genome Assembly: the art of trying to make one BIG thing from millions of ver...Genome Assembly: the art of trying to make one BIG thing from millions of ver...
Genome Assembly: the art of trying to make one BIG thing from millions of ver...Keith Bradnam
 
Transcript detection in RNAseq
Transcript detection in RNAseqTranscript detection in RNAseq
Transcript detection in RNAseqDenis C. Bauer
 
Apollo Introduction for the Chestnut Research Community
Apollo Introduction for the Chestnut Research CommunityApollo Introduction for the Chestnut Research Community
Apollo Introduction for the Chestnut Research CommunityMonica Munoz-Torres
 
The NCBI Eukaryotic Genome Annotation Pipeline and Alternate Genomic Sequences
The NCBI Eukaryotic Genome Annotation Pipeline and Alternate Genomic SequencesThe NCBI Eukaryotic Genome Annotation Pipeline and Alternate Genomic Sequences
The NCBI Eukaryotic Genome Annotation Pipeline and Alternate Genomic SequencesGenome Reference Consortium
 
Computational Protein Design. 2. Computational Protein Design Techniques
Computational Protein Design. 2. Computational Protein Design TechniquesComputational Protein Design. 2. Computational Protein Design Techniques
Computational Protein Design. 2. Computational Protein Design TechniquesPablo Carbonell
 
Wild Strawberry: An emerging model for ecological and evolutionary genomics
Wild Strawberry: An emerging model for ecological and evolutionary genomicsWild Strawberry: An emerging model for ecological and evolutionary genomics
Wild Strawberry: An emerging model for ecological and evolutionary genomicsAaron Liston
 
RNA-seq differential expression analysis
RNA-seq differential expression analysisRNA-seq differential expression analysis
RNA-seq differential expression analysismikaelhuss
 
VectorBase gene sets
VectorBase gene setsVectorBase gene sets
VectorBase gene setsVectorBase
 
Introduction to Apollo: A webinar for the i5K Research Community
Introduction to Apollo: A webinar for the i5K Research CommunityIntroduction to Apollo: A webinar for the i5K Research Community
Introduction to Apollo: A webinar for the i5K Research CommunityMonica Munoz-Torres
 
Genome Curation using Apollo - Workshop at UTK
Genome Curation using Apollo - Workshop at UTKGenome Curation using Apollo - Workshop at UTK
Genome Curation using Apollo - Workshop at UTKMonica Munoz-Torres
 
Catalyzing Plant Science Research with RNA-seq
Catalyzing Plant Science Research with RNA-seqCatalyzing Plant Science Research with RNA-seq
Catalyzing Plant Science Research with RNA-seqManjappa Ganiger
 
SBVRLDNACOMP:AN EFFECTIVE DNA SEQUENCE COMPRESSION ALGORITHM
 SBVRLDNACOMP:AN EFFECTIVE DNA SEQUENCE COMPRESSION ALGORITHM SBVRLDNACOMP:AN EFFECTIVE DNA SEQUENCE COMPRESSION ALGORITHM
SBVRLDNACOMP:AN EFFECTIVE DNA SEQUENCE COMPRESSION ALGORITHMijcsa
 
Introduction to Apollo: i5K E affinis
Introduction to Apollo: i5K E affinisIntroduction to Apollo: i5K E affinis
Introduction to Apollo: i5K E affinisMonica Munoz-Torres
 
Genome assembly: the art of trying to make one big thing from millions of ver...
Genome assembly: the art of trying to make one big thing from millions of ver...Genome assembly: the art of trying to make one big thing from millions of ver...
Genome assembly: the art of trying to make one big thing from millions of ver...Keith Bradnam
 

Tendances (20)

PAINT Family PTHR13451-MUS81
PAINT Family PTHR13451-MUS81PAINT Family PTHR13451-MUS81
PAINT Family PTHR13451-MUS81
 
CRISPR mediated haploid inducer stock development in rice
CRISPR mediated haploid inducer stock development in riceCRISPR mediated haploid inducer stock development in rice
CRISPR mediated haploid inducer stock development in rice
 
Introduction to Apollo for i5k
Introduction to Apollo for i5kIntroduction to Apollo for i5k
Introduction to Apollo for i5k
 
Differential gene expression
Differential gene expressionDifferential gene expression
Differential gene expression
 
Targeted Breeding Applications of CRISPR-Cas
Targeted Breeding Applications of CRISPR-CasTargeted Breeding Applications of CRISPR-Cas
Targeted Breeding Applications of CRISPR-Cas
 
NCBI Boot Camp for Beginners Slides
NCBI Boot Camp for Beginners SlidesNCBI Boot Camp for Beginners Slides
NCBI Boot Camp for Beginners Slides
 
Genome Assembly: the art of trying to make one BIG thing from millions of ver...
Genome Assembly: the art of trying to make one BIG thing from millions of ver...Genome Assembly: the art of trying to make one BIG thing from millions of ver...
Genome Assembly: the art of trying to make one BIG thing from millions of ver...
 
Transcript detection in RNAseq
Transcript detection in RNAseqTranscript detection in RNAseq
Transcript detection in RNAseq
 
Apollo Introduction for the Chestnut Research Community
Apollo Introduction for the Chestnut Research CommunityApollo Introduction for the Chestnut Research Community
Apollo Introduction for the Chestnut Research Community
 
The NCBI Eukaryotic Genome Annotation Pipeline and Alternate Genomic Sequences
The NCBI Eukaryotic Genome Annotation Pipeline and Alternate Genomic SequencesThe NCBI Eukaryotic Genome Annotation Pipeline and Alternate Genomic Sequences
The NCBI Eukaryotic Genome Annotation Pipeline and Alternate Genomic Sequences
 
Computational Protein Design. 2. Computational Protein Design Techniques
Computational Protein Design. 2. Computational Protein Design TechniquesComputational Protein Design. 2. Computational Protein Design Techniques
Computational Protein Design. 2. Computational Protein Design Techniques
 
Wild Strawberry: An emerging model for ecological and evolutionary genomics
Wild Strawberry: An emerging model for ecological and evolutionary genomicsWild Strawberry: An emerging model for ecological and evolutionary genomics
Wild Strawberry: An emerging model for ecological and evolutionary genomics
 
RNA-seq differential expression analysis
RNA-seq differential expression analysisRNA-seq differential expression analysis
RNA-seq differential expression analysis
 
VectorBase gene sets
VectorBase gene setsVectorBase gene sets
VectorBase gene sets
 
Introduction to Apollo: A webinar for the i5K Research Community
Introduction to Apollo: A webinar for the i5K Research CommunityIntroduction to Apollo: A webinar for the i5K Research Community
Introduction to Apollo: A webinar for the i5K Research Community
 
Genome Curation using Apollo - Workshop at UTK
Genome Curation using Apollo - Workshop at UTKGenome Curation using Apollo - Workshop at UTK
Genome Curation using Apollo - Workshop at UTK
 
Catalyzing Plant Science Research with RNA-seq
Catalyzing Plant Science Research with RNA-seqCatalyzing Plant Science Research with RNA-seq
Catalyzing Plant Science Research with RNA-seq
 
SBVRLDNACOMP:AN EFFECTIVE DNA SEQUENCE COMPRESSION ALGORITHM
 SBVRLDNACOMP:AN EFFECTIVE DNA SEQUENCE COMPRESSION ALGORITHM SBVRLDNACOMP:AN EFFECTIVE DNA SEQUENCE COMPRESSION ALGORITHM
SBVRLDNACOMP:AN EFFECTIVE DNA SEQUENCE COMPRESSION ALGORITHM
 
Introduction to Apollo: i5K E affinis
Introduction to Apollo: i5K E affinisIntroduction to Apollo: i5K E affinis
Introduction to Apollo: i5K E affinis
 
Genome assembly: the art of trying to make one big thing from millions of ver...
Genome assembly: the art of trying to make one big thing from millions of ver...Genome assembly: the art of trying to make one big thing from millions of ver...
Genome assembly: the art of trying to make one big thing from millions of ver...
 

En vedette

Investigations on Synthesis, Purification and Characterization of Indium Anti...
Investigations on Synthesis, Purification and Characterization of Indium Anti...Investigations on Synthesis, Purification and Characterization of Indium Anti...
Investigations on Synthesis, Purification and Characterization of Indium Anti...AM Publications
 
Apollo annotation guidelines for i5k projects Diaphorina citri
Apollo annotation guidelines for i5k projects Diaphorina citriApollo annotation guidelines for i5k projects Diaphorina citri
Apollo annotation guidelines for i5k projects Diaphorina citriMonica Munoz-Torres
 
Curation Introduction - Apollo Workshop
Curation Introduction - Apollo WorkshopCuration Introduction - Apollo Workshop
Curation Introduction - Apollo WorkshopMonica Munoz-Torres
 
Diapositivas tuberculosis y salud publica
Diapositivas tuberculosis y salud publica Diapositivas tuberculosis y salud publica
Diapositivas tuberculosis y salud publica CesarArgus96
 
Expert System to Determine the Priority Scale of Case in Laboratory of Forens...
Expert System to Determine the Priority Scale of Case in Laboratory of Forens...Expert System to Determine the Priority Scale of Case in Laboratory of Forens...
Expert System to Determine the Priority Scale of Case in Laboratory of Forens...AM Publications
 
Doppler medios diagnostico y cuidados de enfermeria
Doppler  medios diagnostico y cuidados de enfermeria Doppler  medios diagnostico y cuidados de enfermeria
Doppler medios diagnostico y cuidados de enfermeria CesarArgus96
 
El misterio de la felicidad
El misterio de la felicidadEl misterio de la felicidad
El misterio de la felicidadBernard Sanjuan
 
Task 3 bfi video guide structure
Task 3 bfi video guide structureTask 3 bfi video guide structure
Task 3 bfi video guide structurectkmedia
 

En vedette (12)

Investigations on Synthesis, Purification and Characterization of Indium Anti...
Investigations on Synthesis, Purification and Characterization of Indium Anti...Investigations on Synthesis, Purification and Characterization of Indium Anti...
Investigations on Synthesis, Purification and Characterization of Indium Anti...
 
Apollo annotation guidelines for i5k projects Diaphorina citri
Apollo annotation guidelines for i5k projects Diaphorina citriApollo annotation guidelines for i5k projects Diaphorina citri
Apollo annotation guidelines for i5k projects Diaphorina citri
 
Apollo Workshop at KSU 2015
Apollo Workshop at KSU 2015Apollo Workshop at KSU 2015
Apollo Workshop at KSU 2015
 
Curation Introduction - Apollo Workshop
Curation Introduction - Apollo WorkshopCuration Introduction - Apollo Workshop
Curation Introduction - Apollo Workshop
 
Diapositivas tuberculosis y salud publica
Diapositivas tuberculosis y salud publica Diapositivas tuberculosis y salud publica
Diapositivas tuberculosis y salud publica
 
Expert System to Determine the Priority Scale of Case in Laboratory of Forens...
Expert System to Determine the Priority Scale of Case in Laboratory of Forens...Expert System to Determine the Priority Scale of Case in Laboratory of Forens...
Expert System to Determine the Priority Scale of Case in Laboratory of Forens...
 
Raviz Hotels and Resorts
Raviz Hotels and ResortsRaviz Hotels and Resorts
Raviz Hotels and Resorts
 
Windowns
WindownsWindowns
Windowns
 
Flags
FlagsFlags
Flags
 
Doppler medios diagnostico y cuidados de enfermeria
Doppler  medios diagnostico y cuidados de enfermeria Doppler  medios diagnostico y cuidados de enfermeria
Doppler medios diagnostico y cuidados de enfermeria
 
El misterio de la felicidad
El misterio de la felicidadEl misterio de la felicidad
El misterio de la felicidad
 
Task 3 bfi video guide structure
Task 3 bfi video guide structureTask 3 bfi video guide structure
Task 3 bfi video guide structure
 

Similaire à Apollo Exercises Kansas State University 2015

Genome Editing CRISPR-Cas9
Genome Editing CRISPR-Cas9 Genome Editing CRISPR-Cas9
Genome Editing CRISPR-Cas9 Ek Han Tan
 
Rna lecture
Rna lectureRna lecture
Rna lecturenishulpu
 
Pathema Burkholderia Annotation Jamboree: Prokaryotic Annotation Overview
Pathema Burkholderia Annotation Jamboree: Prokaryotic Annotation OverviewPathema Burkholderia Annotation Jamboree: Prokaryotic Annotation Overview
Pathema Burkholderia Annotation Jamboree: Prokaryotic Annotation OverviewPathema
 
CRISPR cas, a potential tool for targeted genome modification in crops.
CRISPR cas, a potential tool for targeted genome modification in crops.CRISPR cas, a potential tool for targeted genome modification in crops.
CRISPR cas, a potential tool for targeted genome modification in crops.UAS,GKVK<BANGALORE
 
Apollo : A workshop for the Manakin Research Coordination Network
Apollo: A workshop for the Manakin Research Coordination NetworkApollo: A workshop for the Manakin Research Coordination Network
Apollo : A workshop for the Manakin Research Coordination NetworkMonica Munoz-Torres
 
CRISPR Crops--a talk by Sophien Kamoun at Science Portal BD
CRISPR Crops--a talk by Sophien Kamoun at Science Portal BDCRISPR Crops--a talk by Sophien Kamoun at Science Portal BD
CRISPR Crops--a talk by Sophien Kamoun at Science Portal BDSophien Kamoun
 
Marker devt. workshop 27022012
Marker devt. workshop 27022012Marker devt. workshop 27022012
Marker devt. workshop 27022012Koppolu Ravi
 
2015.04.08-Next-generation-sequencing-issues
2015.04.08-Next-generation-sequencing-issues2015.04.08-Next-generation-sequencing-issues
2015.04.08-Next-generation-sequencing-issuesDongyan Zhao
 
Wellstein poster embl meeting nov 2018
Wellstein poster embl meeting nov 2018Wellstein poster embl meeting nov 2018
Wellstein poster embl meeting nov 2018Anne Deslattes Mays
 
Annotating nc-RNAs with Rfam
Annotating nc-RNAs with RfamAnnotating nc-RNAs with Rfam
Annotating nc-RNAs with RfamLuca Cozzuto
 
ONLY THE LAST QUESTION IS THE POINT OF POST. THE OTHER PAGES ARE B.pdf
ONLY THE LAST QUESTION IS THE POINT OF POST. THE OTHER PAGES ARE B.pdfONLY THE LAST QUESTION IS THE POINT OF POST. THE OTHER PAGES ARE B.pdf
ONLY THE LAST QUESTION IS THE POINT OF POST. THE OTHER PAGES ARE B.pdfamzonknr
 
ONLY THE LAST QUESTION IS THE POINT OF POST. THE OTHER PAGES ARE BAC.pdf
ONLY THE LAST QUESTION IS THE POINT OF POST. THE OTHER PAGES ARE BAC.pdfONLY THE LAST QUESTION IS THE POINT OF POST. THE OTHER PAGES ARE BAC.pdf
ONLY THE LAST QUESTION IS THE POINT OF POST. THE OTHER PAGES ARE BAC.pdfamzonknr
 
Gene prediction and expression
Gene prediction and expressionGene prediction and expression
Gene prediction and expressionishi tandon
 

Similaire à Apollo Exercises Kansas State University 2015 (20)

Genome Editing CRISPR-Cas9
Genome Editing CRISPR-Cas9 Genome Editing CRISPR-Cas9
Genome Editing CRISPR-Cas9
 
Rna lecture
Rna lectureRna lecture
Rna lecture
 
Pathema Burkholderia Annotation Jamboree: Prokaryotic Annotation Overview
Pathema Burkholderia Annotation Jamboree: Prokaryotic Annotation OverviewPathema Burkholderia Annotation Jamboree: Prokaryotic Annotation Overview
Pathema Burkholderia Annotation Jamboree: Prokaryotic Annotation Overview
 
20140710 6 c_mason_ercc2.0_workshop
20140710 6 c_mason_ercc2.0_workshop20140710 6 c_mason_ercc2.0_workshop
20140710 6 c_mason_ercc2.0_workshop
 
CRISPR cas, a potential tool for targeted genome modification in crops.
CRISPR cas, a potential tool for targeted genome modification in crops.CRISPR cas, a potential tool for targeted genome modification in crops.
CRISPR cas, a potential tool for targeted genome modification in crops.
 
Apollo : A workshop for the Manakin Research Coordination Network
Apollo: A workshop for the Manakin Research Coordination NetworkApollo: A workshop for the Manakin Research Coordination Network
Apollo : A workshop for the Manakin Research Coordination Network
 
CRISPR Crops--a talk by Sophien Kamoun at Science Portal BD
CRISPR Crops--a talk by Sophien Kamoun at Science Portal BDCRISPR Crops--a talk by Sophien Kamoun at Science Portal BD
CRISPR Crops--a talk by Sophien Kamoun at Science Portal BD
 
Iplant pag
Iplant pagIplant pag
Iplant pag
 
Marker devt. workshop 27022012
Marker devt. workshop 27022012Marker devt. workshop 27022012
Marker devt. workshop 27022012
 
2015.04.08-Next-generation-sequencing-issues
2015.04.08-Next-generation-sequencing-issues2015.04.08-Next-generation-sequencing-issues
2015.04.08-Next-generation-sequencing-issues
 
Protein Science 2004
Protein Science 2004Protein Science 2004
Protein Science 2004
 
Wellstein poster embl meeting nov 2018
Wellstein poster embl meeting nov 2018Wellstein poster embl meeting nov 2018
Wellstein poster embl meeting nov 2018
 
Shotgun and clone contig method
Shotgun and clone contig methodShotgun and clone contig method
Shotgun and clone contig method
 
Protein databases
Protein databasesProtein databases
Protein databases
 
Annotating nc-RNAs with Rfam
Annotating nc-RNAs with RfamAnnotating nc-RNAs with Rfam
Annotating nc-RNAs with Rfam
 
Crispr/cas9 101
Crispr/cas9 101Crispr/cas9 101
Crispr/cas9 101
 
ONLY THE LAST QUESTION IS THE POINT OF POST. THE OTHER PAGES ARE B.pdf
ONLY THE LAST QUESTION IS THE POINT OF POST. THE OTHER PAGES ARE B.pdfONLY THE LAST QUESTION IS THE POINT OF POST. THE OTHER PAGES ARE B.pdf
ONLY THE LAST QUESTION IS THE POINT OF POST. THE OTHER PAGES ARE B.pdf
 
ONLY THE LAST QUESTION IS THE POINT OF POST. THE OTHER PAGES ARE BAC.pdf
ONLY THE LAST QUESTION IS THE POINT OF POST. THE OTHER PAGES ARE BAC.pdfONLY THE LAST QUESTION IS THE POINT OF POST. THE OTHER PAGES ARE BAC.pdf
ONLY THE LAST QUESTION IS THE POINT OF POST. THE OTHER PAGES ARE BAC.pdf
 
Gene prediction and expression
Gene prediction and expressionGene prediction and expression
Gene prediction and expression
 
Crispr
CrisprCrispr
Crispr
 

Plus de Monica Munoz-Torres

Apollo Workshop AGS2017 Editing functionality
Apollo Workshop AGS2017 Editing functionalityApollo Workshop AGS2017 Editing functionality
Apollo Workshop AGS2017 Editing functionalityMonica Munoz-Torres
 
Apollo Workshop AGS2017 Introduction
Apollo Workshop AGS2017 IntroductionApollo Workshop AGS2017 Introduction
Apollo Workshop AGS2017 IntroductionMonica Munoz-Torres
 
Editing Functionality - Apollo Workshop
Editing Functionality - Apollo WorkshopEditing Functionality - Apollo Workshop
Editing Functionality - Apollo WorkshopMonica Munoz-Torres
 
Apollo Collaborative genome annotation editing
Apollo Collaborative genome annotation editing Apollo Collaborative genome annotation editing
Apollo Collaborative genome annotation editing Monica Munoz-Torres
 
JBrowse & Apollo Overview - for AGR
JBrowse & Apollo Overview - for AGRJBrowse & Apollo Overview - for AGR
JBrowse & Apollo Overview - for AGRMonica Munoz-Torres
 
Apollo Genome Annotation Editor: Latest Updates, Including New Galaxy Integra...
Apollo Genome Annotation Editor: Latest Updates, Including New Galaxy Integra...Apollo Genome Annotation Editor: Latest Updates, Including New Galaxy Integra...
Apollo Genome Annotation Editor: Latest Updates, Including New Galaxy Integra...Monica Munoz-Torres
 
Introduction to Apollo - i5k Research Community – Calanoida (copepod)
Introduction to Apollo - i5k Research Community – Calanoida (copepod)Introduction to Apollo - i5k Research Community – Calanoida (copepod)
Introduction to Apollo - i5k Research Community – Calanoida (copepod)Monica Munoz-Torres
 
Gene Ontology Consortium: Website & COmmunity
Gene Ontology Consortium: Website & COmmunityGene Ontology Consortium: Website & COmmunity
Gene Ontology Consortium: Website & COmmunityMonica Munoz-Torres
 
Essential Requirements for Community Annotation Tools
Essential Requirements for Community Annotation ToolsEssential Requirements for Community Annotation Tools
Essential Requirements for Community Annotation ToolsMonica Munoz-Torres
 
Apollo Introduction for i5K Groups 2015-10-07
Apollo Introduction for i5K Groups 2015-10-07Apollo Introduction for i5K Groups 2015-10-07
Apollo Introduction for i5K Groups 2015-10-07Monica Munoz-Torres
 
CONSORCIO ONTOLOGÍA DE GENES: herramientas para anotación funcional
CONSORCIO ONTOLOGÍA DE GENES: herramientas para anotación funcionalCONSORCIO ONTOLOGÍA DE GENES: herramientas para anotación funcional
CONSORCIO ONTOLOGÍA DE GENES: herramientas para anotación funcionalMonica Munoz-Torres
 
Apollo - A webinar for the Phascolarctos cinereus research community
Apollo - A webinar for the Phascolarctos cinereus research communityApollo - A webinar for the Phascolarctos cinereus research community
Apollo - A webinar for the Phascolarctos cinereus research communityMonica Munoz-Torres
 
Apollo: Scalable & collaborative curation of genomes - Biocuration 2015
Apollo: Scalable & collaborative curation of genomes - Biocuration 2015Apollo: Scalable & collaborative curation of genomes - Biocuration 2015
Apollo: Scalable & collaborative curation of genomes - Biocuration 2015Monica Munoz-Torres
 
Data Visualization And Annotation Workshop at Biocuration 2015
Data Visualization And Annotation Workshop at Biocuration 2015Data Visualization And Annotation Workshop at Biocuration 2015
Data Visualization And Annotation Workshop at Biocuration 2015Monica Munoz-Torres
 
Apollo: developers call 2015-02-05
Apollo: developers call 2015-02-05Apollo: developers call 2015-02-05
Apollo: developers call 2015-02-05Monica Munoz-Torres
 
Apollo and i5K: Collaborative Curation and Interactive Analysis of Genomes
Apollo and i5K: Collaborative Curation and Interactive Analysis of GenomesApollo and i5K: Collaborative Curation and Interactive Analysis of Genomes
Apollo and i5K: Collaborative Curation and Interactive Analysis of GenomesMonica Munoz-Torres
 
Web Apollo Workshop University of Exeter
Web Apollo Workshop University of ExeterWeb Apollo Workshop University of Exeter
Web Apollo Workshop University of ExeterMonica Munoz-Torres
 
Munoz torres web-apollo-workshop_exeter-2014_ss
Munoz torres web-apollo-workshop_exeter-2014_ssMunoz torres web-apollo-workshop_exeter-2014_ss
Munoz torres web-apollo-workshop_exeter-2014_ssMonica Munoz-Torres
 

Plus de Monica Munoz-Torres (19)

Apollo Workshop AGS2017 Editing functionality
Apollo Workshop AGS2017 Editing functionalityApollo Workshop AGS2017 Editing functionality
Apollo Workshop AGS2017 Editing functionality
 
Apollo Workshop AGS2017 Introduction
Apollo Workshop AGS2017 IntroductionApollo Workshop AGS2017 Introduction
Apollo Workshop AGS2017 Introduction
 
Editing Functionality - Apollo Workshop
Editing Functionality - Apollo WorkshopEditing Functionality - Apollo Workshop
Editing Functionality - Apollo Workshop
 
Apollo Collaborative genome annotation editing
Apollo Collaborative genome annotation editing Apollo Collaborative genome annotation editing
Apollo Collaborative genome annotation editing
 
JBrowse & Apollo Overview - for AGR
JBrowse & Apollo Overview - for AGRJBrowse & Apollo Overview - for AGR
JBrowse & Apollo Overview - for AGR
 
Apollo Genome Annotation Editor: Latest Updates, Including New Galaxy Integra...
Apollo Genome Annotation Editor: Latest Updates, Including New Galaxy Integra...Apollo Genome Annotation Editor: Latest Updates, Including New Galaxy Integra...
Apollo Genome Annotation Editor: Latest Updates, Including New Galaxy Integra...
 
Introduction to Apollo - i5k Research Community – Calanoida (copepod)
Introduction to Apollo - i5k Research Community – Calanoida (copepod)Introduction to Apollo - i5k Research Community – Calanoida (copepod)
Introduction to Apollo - i5k Research Community – Calanoida (copepod)
 
Gene Ontology Consortium: Website & COmmunity
Gene Ontology Consortium: Website & COmmunityGene Ontology Consortium: Website & COmmunity
Gene Ontology Consortium: Website & COmmunity
 
Essential Requirements for Community Annotation Tools
Essential Requirements for Community Annotation ToolsEssential Requirements for Community Annotation Tools
Essential Requirements for Community Annotation Tools
 
Apollo Introduction for i5K Groups 2015-10-07
Apollo Introduction for i5K Groups 2015-10-07Apollo Introduction for i5K Groups 2015-10-07
Apollo Introduction for i5K Groups 2015-10-07
 
CONSORCIO ONTOLOGÍA DE GENES: herramientas para anotación funcional
CONSORCIO ONTOLOGÍA DE GENES: herramientas para anotación funcionalCONSORCIO ONTOLOGÍA DE GENES: herramientas para anotación funcional
CONSORCIO ONTOLOGÍA DE GENES: herramientas para anotación funcional
 
Apolo Taller en BIOS
Apolo Taller en BIOS Apolo Taller en BIOS
Apolo Taller en BIOS
 
Apollo - A webinar for the Phascolarctos cinereus research community
Apollo - A webinar for the Phascolarctos cinereus research communityApollo - A webinar for the Phascolarctos cinereus research community
Apollo - A webinar for the Phascolarctos cinereus research community
 
Apollo: Scalable & collaborative curation of genomes - Biocuration 2015
Apollo: Scalable & collaborative curation of genomes - Biocuration 2015Apollo: Scalable & collaborative curation of genomes - Biocuration 2015
Apollo: Scalable & collaborative curation of genomes - Biocuration 2015
 
Data Visualization And Annotation Workshop at Biocuration 2015
Data Visualization And Annotation Workshop at Biocuration 2015Data Visualization And Annotation Workshop at Biocuration 2015
Data Visualization And Annotation Workshop at Biocuration 2015
 
Apollo: developers call 2015-02-05
Apollo: developers call 2015-02-05Apollo: developers call 2015-02-05
Apollo: developers call 2015-02-05
 
Apollo and i5K: Collaborative Curation and Interactive Analysis of Genomes
Apollo and i5K: Collaborative Curation and Interactive Analysis of GenomesApollo and i5K: Collaborative Curation and Interactive Analysis of Genomes
Apollo and i5K: Collaborative Curation and Interactive Analysis of Genomes
 
Web Apollo Workshop University of Exeter
Web Apollo Workshop University of ExeterWeb Apollo Workshop University of Exeter
Web Apollo Workshop University of Exeter
 
Munoz torres web-apollo-workshop_exeter-2014_ss
Munoz torres web-apollo-workshop_exeter-2014_ssMunoz torres web-apollo-workshop_exeter-2014_ss
Munoz torres web-apollo-workshop_exeter-2014_ss
 

Dernier

Pests of cotton_Borer_Pests_Binomics_Dr.UPR.pdf
Pests of cotton_Borer_Pests_Binomics_Dr.UPR.pdfPests of cotton_Borer_Pests_Binomics_Dr.UPR.pdf
Pests of cotton_Borer_Pests_Binomics_Dr.UPR.pdfPirithiRaju
 
Hubble Asteroid Hunter III. Physical properties of newly found asteroids
Hubble Asteroid Hunter III. Physical properties of newly found asteroidsHubble Asteroid Hunter III. Physical properties of newly found asteroids
Hubble Asteroid Hunter III. Physical properties of newly found asteroidsSérgio Sacani
 
Botany krishna series 2nd semester Only Mcq type questions
Botany krishna series 2nd semester Only Mcq type questionsBotany krishna series 2nd semester Only Mcq type questions
Botany krishna series 2nd semester Only Mcq type questionsSumit Kumar yadav
 
Nightside clouds and disequilibrium chemistry on the hot Jupiter WASP-43b
Nightside clouds and disequilibrium chemistry on the hot Jupiter WASP-43bNightside clouds and disequilibrium chemistry on the hot Jupiter WASP-43b
Nightside clouds and disequilibrium chemistry on the hot Jupiter WASP-43bSérgio Sacani
 
Discovery of an Accretion Streamer and a Slow Wide-angle Outflow around FUOri...
Discovery of an Accretion Streamer and a Slow Wide-angle Outflow around FUOri...Discovery of an Accretion Streamer and a Slow Wide-angle Outflow around FUOri...
Discovery of an Accretion Streamer and a Slow Wide-angle Outflow around FUOri...Sérgio Sacani
 
Spermiogenesis or Spermateleosis or metamorphosis of spermatid
Spermiogenesis or Spermateleosis or metamorphosis of spermatidSpermiogenesis or Spermateleosis or metamorphosis of spermatid
Spermiogenesis or Spermateleosis or metamorphosis of spermatidSarthak Sekhar Mondal
 
Pests of cotton_Sucking_Pests_Dr.UPR.pdf
Pests of cotton_Sucking_Pests_Dr.UPR.pdfPests of cotton_Sucking_Pests_Dr.UPR.pdf
Pests of cotton_Sucking_Pests_Dr.UPR.pdfPirithiRaju
 
Recombinant DNA technology (Immunological screening)
Recombinant DNA technology (Immunological screening)Recombinant DNA technology (Immunological screening)
Recombinant DNA technology (Immunological screening)PraveenaKalaiselvan1
 
Green chemistry and Sustainable development.pptx
Green chemistry  and Sustainable development.pptxGreen chemistry  and Sustainable development.pptx
Green chemistry and Sustainable development.pptxRajatChauhan518211
 
All-domain Anomaly Resolution Office U.S. Department of Defense (U) Case: “Eg...
All-domain Anomaly Resolution Office U.S. Department of Defense (U) Case: “Eg...All-domain Anomaly Resolution Office U.S. Department of Defense (U) Case: “Eg...
All-domain Anomaly Resolution Office U.S. Department of Defense (U) Case: “Eg...Sérgio Sacani
 
GBSN - Microbiology (Unit 2)
GBSN - Microbiology (Unit 2)GBSN - Microbiology (Unit 2)
GBSN - Microbiology (Unit 2)Areesha Ahmad
 
Physiochemical properties of nanomaterials and its nanotoxicity.pptx
Physiochemical properties of nanomaterials and its nanotoxicity.pptxPhysiochemical properties of nanomaterials and its nanotoxicity.pptx
Physiochemical properties of nanomaterials and its nanotoxicity.pptxAArockiyaNisha
 
fundamental of entomology all in one topics of entomology
fundamental of entomology all in one topics of entomologyfundamental of entomology all in one topics of entomology
fundamental of entomology all in one topics of entomologyDrAnita Sharma
 
Presentation Vikram Lander by Vedansh Gupta.pptx
Presentation Vikram Lander by Vedansh Gupta.pptxPresentation Vikram Lander by Vedansh Gupta.pptx
Presentation Vikram Lander by Vedansh Gupta.pptxgindu3009
 
CALL ON ➥8923113531 🔝Call Girls Kesar Bagh Lucknow best Night Fun service 🪡
CALL ON ➥8923113531 🔝Call Girls Kesar Bagh Lucknow best Night Fun service  🪡CALL ON ➥8923113531 🔝Call Girls Kesar Bagh Lucknow best Night Fun service  🪡
CALL ON ➥8923113531 🔝Call Girls Kesar Bagh Lucknow best Night Fun service 🪡anilsa9823
 
PossibleEoarcheanRecordsoftheGeomagneticFieldPreservedintheIsuaSupracrustalBe...
PossibleEoarcheanRecordsoftheGeomagneticFieldPreservedintheIsuaSupracrustalBe...PossibleEoarcheanRecordsoftheGeomagneticFieldPreservedintheIsuaSupracrustalBe...
PossibleEoarcheanRecordsoftheGeomagneticFieldPreservedintheIsuaSupracrustalBe...Sérgio Sacani
 
Formation of low mass protostars and their circumstellar disks
Formation of low mass protostars and their circumstellar disksFormation of low mass protostars and their circumstellar disks
Formation of low mass protostars and their circumstellar disksSérgio Sacani
 
GBSN - Biochemistry (Unit 1)
GBSN - Biochemistry (Unit 1)GBSN - Biochemistry (Unit 1)
GBSN - Biochemistry (Unit 1)Areesha Ahmad
 
Hire 💕 9907093804 Hooghly Call Girls Service Call Girls Agency
Hire 💕 9907093804 Hooghly Call Girls Service Call Girls AgencyHire 💕 9907093804 Hooghly Call Girls Service Call Girls Agency
Hire 💕 9907093804 Hooghly Call Girls Service Call Girls AgencySheetal Arora
 
Disentangling the origin of chemical differences using GHOST
Disentangling the origin of chemical differences using GHOSTDisentangling the origin of chemical differences using GHOST
Disentangling the origin of chemical differences using GHOSTSérgio Sacani
 

Dernier (20)

Pests of cotton_Borer_Pests_Binomics_Dr.UPR.pdf
Pests of cotton_Borer_Pests_Binomics_Dr.UPR.pdfPests of cotton_Borer_Pests_Binomics_Dr.UPR.pdf
Pests of cotton_Borer_Pests_Binomics_Dr.UPR.pdf
 
Hubble Asteroid Hunter III. Physical properties of newly found asteroids
Hubble Asteroid Hunter III. Physical properties of newly found asteroidsHubble Asteroid Hunter III. Physical properties of newly found asteroids
Hubble Asteroid Hunter III. Physical properties of newly found asteroids
 
Botany krishna series 2nd semester Only Mcq type questions
Botany krishna series 2nd semester Only Mcq type questionsBotany krishna series 2nd semester Only Mcq type questions
Botany krishna series 2nd semester Only Mcq type questions
 
Nightside clouds and disequilibrium chemistry on the hot Jupiter WASP-43b
Nightside clouds and disequilibrium chemistry on the hot Jupiter WASP-43bNightside clouds and disequilibrium chemistry on the hot Jupiter WASP-43b
Nightside clouds and disequilibrium chemistry on the hot Jupiter WASP-43b
 
Discovery of an Accretion Streamer and a Slow Wide-angle Outflow around FUOri...
Discovery of an Accretion Streamer and a Slow Wide-angle Outflow around FUOri...Discovery of an Accretion Streamer and a Slow Wide-angle Outflow around FUOri...
Discovery of an Accretion Streamer and a Slow Wide-angle Outflow around FUOri...
 
Spermiogenesis or Spermateleosis or metamorphosis of spermatid
Spermiogenesis or Spermateleosis or metamorphosis of spermatidSpermiogenesis or Spermateleosis or metamorphosis of spermatid
Spermiogenesis or Spermateleosis or metamorphosis of spermatid
 
Pests of cotton_Sucking_Pests_Dr.UPR.pdf
Pests of cotton_Sucking_Pests_Dr.UPR.pdfPests of cotton_Sucking_Pests_Dr.UPR.pdf
Pests of cotton_Sucking_Pests_Dr.UPR.pdf
 
Recombinant DNA technology (Immunological screening)
Recombinant DNA technology (Immunological screening)Recombinant DNA technology (Immunological screening)
Recombinant DNA technology (Immunological screening)
 
Green chemistry and Sustainable development.pptx
Green chemistry  and Sustainable development.pptxGreen chemistry  and Sustainable development.pptx
Green chemistry and Sustainable development.pptx
 
All-domain Anomaly Resolution Office U.S. Department of Defense (U) Case: “Eg...
All-domain Anomaly Resolution Office U.S. Department of Defense (U) Case: “Eg...All-domain Anomaly Resolution Office U.S. Department of Defense (U) Case: “Eg...
All-domain Anomaly Resolution Office U.S. Department of Defense (U) Case: “Eg...
 
GBSN - Microbiology (Unit 2)
GBSN - Microbiology (Unit 2)GBSN - Microbiology (Unit 2)
GBSN - Microbiology (Unit 2)
 
Physiochemical properties of nanomaterials and its nanotoxicity.pptx
Physiochemical properties of nanomaterials and its nanotoxicity.pptxPhysiochemical properties of nanomaterials and its nanotoxicity.pptx
Physiochemical properties of nanomaterials and its nanotoxicity.pptx
 
fundamental of entomology all in one topics of entomology
fundamental of entomology all in one topics of entomologyfundamental of entomology all in one topics of entomology
fundamental of entomology all in one topics of entomology
 
Presentation Vikram Lander by Vedansh Gupta.pptx
Presentation Vikram Lander by Vedansh Gupta.pptxPresentation Vikram Lander by Vedansh Gupta.pptx
Presentation Vikram Lander by Vedansh Gupta.pptx
 
CALL ON ➥8923113531 🔝Call Girls Kesar Bagh Lucknow best Night Fun service 🪡
CALL ON ➥8923113531 🔝Call Girls Kesar Bagh Lucknow best Night Fun service  🪡CALL ON ➥8923113531 🔝Call Girls Kesar Bagh Lucknow best Night Fun service  🪡
CALL ON ➥8923113531 🔝Call Girls Kesar Bagh Lucknow best Night Fun service 🪡
 
PossibleEoarcheanRecordsoftheGeomagneticFieldPreservedintheIsuaSupracrustalBe...
PossibleEoarcheanRecordsoftheGeomagneticFieldPreservedintheIsuaSupracrustalBe...PossibleEoarcheanRecordsoftheGeomagneticFieldPreservedintheIsuaSupracrustalBe...
PossibleEoarcheanRecordsoftheGeomagneticFieldPreservedintheIsuaSupracrustalBe...
 
Formation of low mass protostars and their circumstellar disks
Formation of low mass protostars and their circumstellar disksFormation of low mass protostars and their circumstellar disks
Formation of low mass protostars and their circumstellar disks
 
GBSN - Biochemistry (Unit 1)
GBSN - Biochemistry (Unit 1)GBSN - Biochemistry (Unit 1)
GBSN - Biochemistry (Unit 1)
 
Hire 💕 9907093804 Hooghly Call Girls Service Call Girls Agency
Hire 💕 9907093804 Hooghly Call Girls Service Call Girls AgencyHire 💕 9907093804 Hooghly Call Girls Service Call Girls Agency
Hire 💕 9907093804 Hooghly Call Girls Service Call Girls Agency
 
Disentangling the origin of chemical differences using GHOST
Disentangling the origin of chemical differences using GHOSTDisentangling the origin of chemical differences using GHOST
Disentangling the origin of chemical differences using GHOST
 

Apollo Exercises Kansas State University 2015

  • 1.     # Web Apollo Workshop - Exercises # At Kansas State University # 17 June, 2015 # M. Munoz-Torres # Berkeley Bioinformatics Open Source Projects # Lawrence Berkeley National Laboratory ----------------------------------------------------------------------- # Web Apollo Workshop - KSU # Exercise 1 It has come to our attention that the Apis mellifera (honey bee) ortholog of Nesprin-1 (nuclear envelope spectrin repeat proteins) or Muscle specific protein 300 is fragmented into possibly 5 different genes in the current gene set. In Drosophila melanogaster MSP-300 anchors nuclei to actin, and has been reported to be essential for positioning of nurse cell nuclei during oogenesis, and thus production of mature ooctyes. More information available at http://en.wikipedia.org/wiki/Nesprin You may use this fragment from the Megachile rotundata (the alfalfa leafcutter bee) model (NCBI identifier XP_003705060.1; at http://www.ncbi.nlm.nih.gov/) to pull the corresponding location in Apis mellifera using BLAT. The protein has over 12K amino acid residues in M. rotundata. >M_rotundata nesprin-1-like (fragment) MRIVEGRYSGSGGYWNVTILEGGDTGTWGYQKVGILERGGTRRWGYWNVGVPEGGDTGTWGYQKVGILER GGTRRWGYWNVGVPEGGDTGTWGYQKVGILERGGTRRWGYWNVGVPEGGDTGTWGDSGAWGYWNVRILEG GDTGTWRYQKVWSGGRTASSEELFQELDGRRNVGHFRSPTNPRPSSRASDSSFEESFERLVEEGELNGAK VVKFEKITVRKSVREVAGTGVSHQRVLAETSRTPSEEHALEDSAYQSHSHGAPSHGSKSSSVTSFTRFPS EESLSQRRGSSPQQHLGPDDRTPSEWYAEYHTQSFQNVAARIEYVRSKSEYDAHIAEIKDEQERVQKKTF VNWINSYLSKRIPPLRVDDLIDDLKDGTRLLALLEVLSGEKLPVERGRNLKRPHFLSNANTALQFLQS Gene models GB40006-RA and GB40007-RA have significant sequence similarity with this gene model. Using the entire M. rotundata model, shows high-scoring segment pairs (hsp) across GB40006- RA, GB40007-RA, GB40008-RA, GB40009-RA, and GB40010-RA. Clear highlight. Drag and merge GB40006-RA, GB40007-RA, and GB40008-RA Rename transcript to: nesprin-1-like-RA Observing Nurse RNA-seq reads, there are no reads in support of the exon at 483,800 - 483,705, while there are many reads in support of an intron passing across the region. Delete the exon (#1 of GB40007-RA). Closer inspection of RNA-seq reads also reveals that there are many reads in support of NOT having an exon in coordinates 494,235 - 491,660. Delete exon (#2 of GB40006-RA). It is now time to inspect the adjacent exons at the merging of GB40007-RA and GB40008-RA. Guided by RNA-seq reads (their length, not their exact coordinates), the phase and the structure of all exons downstream (3') of 454,041 (… 453,654), you may adjust the coordinates for the adjacent exons in this region, so they may have canonical splice sites. Monica Munoz-Torres, PhD Lead Biocurator | Bioinformatics Analyst Lawrence Berkeley National Laboratory Joint Genome Institute for the US Department of Energy 2800 Mitchell Dr. Ste 100. Walnut Creek, CA 94598 mcmunozt@lbl.gov | @monimunozto | (925) 296-5624
  • 2.     First, the last exon of GB40007-RA can be adjusted to the nearest canonical splice, located 5' in position 454,041. There is a gap between 453,759 .. 453,710. The first exon of GB40008-RA should also be adjusted to the nearest canonical site that extends the protein and is supported by RNA-seq reads. After trying a few sites, position 453,659 is a canonical splice site that conserves the phase of the rest of the product and matches the boundaries of RNAseq reads (-2 -- f 1,2,3). There are many exons in this model; compared to the previous bee model for A. mellifera (in NCBI), there is an excess of about 20 exons. This newly created gene product is 7,600 amino acids in length. Use this product to query NCBI's nr for orthologs, using BLAST at http://blast.ncbi.nlm.nih.gov/Blast.cgi The search retrieves homologs from other Apidae (A. dorsata, A. florea, N. vitripennis, B. impatiens) of similar length --> ~39Kbp, 12K aa. Modify the exon coordinates at the flagged non-canonical sites at the junctions of gene models using RNAseq to guide the changes and use "color by CDS" feature to preserve the phase. RNA-seq shows that the last exon in GB40008-RA may not be real (or perhaps, it is possible that there are more than one isoform (at 431,750)). There are 11 isoforms in D. melanogaster. With RNA-seq evidence as support, use Apollo’s 'edge-matching' functionality to modify the 5' end of the first exon of GB40009-RA to match the boundary of transcripts from 431,668 to that matching RNAseq evidence at 431,683 (choose exon and RNA-seq read, right-click, 'set as 5' end'). Remember: only those reads oriented in the same sense as the transcription will work with the ‘set as x’ end’ operation. Name this isoform (RA) and create a copy using the option "Duplicate" from the right-click menu. In the second isoform (RB), delete exon at ~431,750 (last exon of GB40008-RA) to reveal that the phase in the rest of the peptide is restored to that of original gene model. Copy the 9009 aa residues and query the public databases again using BLAST at NCBI. Merge the model with GB40010-RA, rename to reflect that this is isoform B. At the junction, follow RNA-seq reads pattern to adjust the last exon of GB40009-RA to canonical splice site at 427,372, and the first exon of GB40010-RA to canonical splice site at 427,069 immediately 3' of the GAP and the longest extension supported by RNA-seq data. You may also use additional evidence tracks to support these decisions: e.g. Forager Illumina Bee Contigs, Mixed Antennae 454 Contigs, and Fgenesh++ with RNAseq training data. In this peptide, at position 394,197 a GC splice donor (common in insects) is visible and heavily supported by the evidence. (GC/AG instead of GT/AG). Note on the comments and finish the annotation. A final product of 16,509aa in length is obtained. Check integrity and accuracy: - blastp vs Insecta (at NCBI) (-Apis mellifera ; i.e. without honey bee) - add GO terms (from Drosophila entries - PAINT) - search the literature to add PubMed IDs (http://www.ncbi.nlm.nih.gov/pubmed).
  • 3.     ----------------------------------------------------------------------- # Web Apollo Workshop - KSU # Exercise 2 It has come to our attention that the honey bee ortholog of small ribonucleoprotein particle protein SmD2 is fragmented into 2 or more genes in the current gene set. In Drosophila melanogaster SmD2 are involved in mRNA splicing, via spliceosome. You may use the Apis florea model (XP_003697276.1) to pull the corresponding location in Apis mellifera using BLAT. >A_florea Sm D2-like MLNNIRNITYFSDQSSLTKPKSEMTPEELAKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVK AFDRHCNMVLENVKEMWTELPRTGKGKKKAKPVNKDRFISKMFLRGDSVILVLRNPLATASGK Drag the honey bee gene model you found into the 'User-created Annotation Area' and retrieve its sequence to query the public databases with it to inspect their structure. Query NCBI's nr for orthologs, using BLAST at http://blast.ncbi.nlm.nih.gov/Blast.cgi Review conserved domains, compare the alignments with other sequences and inspect their length differences. Find evidence in support of this model looking through the transcriptomes of Forager bees and Nurse bees as well as available ESTs. For now, please refrain from using previous bee gene models. RNA-seq evidence will support current exons, as well as an additional exon in the 5'end. Check integrity and accuracy: - blastp vs Insecta (at NCBI) (-Apis mellifera) - add GO terms (e.g. from Drosophila entries) - search the literature to add PubMed IDs (http://www.ncbi.nlm.nih.gov/pubmed). After checking the current protein product vs public databases, alignments will show a discrepancy in the 5'end. Can you spot the difference? Are you able to find the missing residues in the current A. mellifera genome assembly? Is there enough evidence to support this hypothesis? How many isoforms would you annotate in this case?
  • 4.     ----------------------------------------------------------------------- # Web Apollo Workshop - KSU # Exercise 3 It has come to our attention that the honey bee ortholog of FlyBase model CG31619 is fragmented into 2 or more genes in the current gene set. In Drosophila melanogaster CG31619 is involved in proteolysis, and has metalloendopeptidase activity (molecular function). We know that the homolog of CG31619 in Apis dorsata is similar to the ADAMTS proteins. ADAMTS = A Disintegrin And Metalloproteinase with Thrombospondin Motifs, which is a family of peptidases. You may use the Apis dorsata model (XP_003697278.1) to pull the corresponding location in Apis mellifera using BLAT in Apollo. >Apis_dorsata ADAMTS-like protein partial RENPRYWLQPCENPSDFRSEQCAAFDDVPYSGQLLKWYPHYDPSRPCALICRGEQSVENTGNRLRQE TSVEKTLPHDATDALQLDSEETIVVQLADKVEDGTKCYTDSMDVCINGECMKVGCDLRVGSNKNTDPCGV CGGNGSSCQSRYSWSLESISACSKSCGGGFKIAMAVCKAIGPDESVVDDSYCDPDNRPEKTLMPCNTHPC Drag each of the honey bee gene models you found into the 'User-created Annotation Area' and retrieve their sequences to query the public databases with them to inspect their structure. Query NCBI's nr database for orthologs, using BLAST at http://blast.ncbi.nlm.nih.gov/Blast.cgi Review conserved domains, compare the alignments with other sequences and inspect their length differences. Once you inspect the expected conserved domains, it will be apparent that the models need to be brought together. Find evidence in support of this operation looking through the transcriptomes of Forager bees and Nurse bees as well as available ESTs. For now, please refrain from using previous bee gene models. The available evidence will show support of splice site corrections and possible excess of exons. Once you are satisfied with a final model, check integrity and accuracy: - blastp vs Insecta (at NCBI) (-Apis mellifera) - add GO terms (e.g from Drosophila entries) - search the literature to add PubMed IDs (http://www.ncbi.nlm.nih.gov/pubmed).
  • 5.     ----------------------------------------------------------------------- # Web Apollo Workshop – KSU # Exercise 4 It has come to our attention that the honey bee ortholog of RNA Polymerase II 140 KD is fragmented into 2 or more genes in the current gene set. In Drosophila melanogaster RNA Pol II is involved in transcription from RNA polymerase II promoter and has DNA binding and DNA-directed RNA polymerase activity (molecular functions). You may use the Apis dorsata model (XP_006610182.1) to pull the corresponding location in Apis mellifera using BLAT in Apollo. >Apis_dorsata RNA pol II subunit RPB2-like partial MYSLEEDQYDDEDAEEISSKLWQEACWIVINAYFDEKGLVRQQLDSFDEFIEMSVQRIVEDSPQIDLQAE AQHTSGEIENPVRHLLKFEQIYLSKPTHWEKDGAPSPMMPNEARLRNLTYSAPLYVDITKTIVKDGEDPI ETQHQKTFIGKIPIMLRSKYCLLAGLSDRDLTELNECPLDPG Drag each of the honey bee gene models you found into the 'User-created Annotation Area' and retrieve their sequences to query the public databases with them to inspect their structure. Query NCBI's nr for orthologs, using BLAST at http://blast.ncbi.nlm.nih.gov/Blast.cgi Check to notice the conserved domains -- are they intact in each model? Will bringing these models together improve the integrity of the RNA Pol II subunit RPB2 homolog in honey bee? Re-arrange the boundaries at the joining region to be canonical splice sites on each side. Did you spot the sequence error visible in the DNA-Track? What effect do you think this had on the automated annotation process? Once you are satisfied with a final model, check integrity and accuracy: - blastp vs Insecta (at NCBI) (-Apis mellifera) - add GO terms (e.g. from Drosophila entries) - search the literature to add PubMed IDs (http://www.ncbi.nlm.nih.gov/pubmed).
  • 6.     ----------------------------------------------------------------------- # Web Apollo Workshop - KSU # Exercise 5 It has come to our attention that the honey bee ortholog of Ceramidase is fragmented into 2 or more genes in the current gene set. Ceramidase is an enzyme, which cleaves fatty acids from ceramide, producing sphingosine (SPH) which in turn is phosphorylated by a sphingosine kinase to form sphingosine-1-phosphate (S1P). Ceramide, SPH, and S1P are bioactive lipids that mediate cell proliferation, differentiation, apoptosis, adhesion, and migration. You may use the Bombus terrestris model (XP_003397164.1) to pull the corresponding location in Apis mellifera using BLAT. The following is a fragment. >B_terrestris Ceramidase-like GTTTAAGAGTGTTCGCGCCAATTGTTCGCGGCGAGACTGGCCGTGCAGACCAGCTGTTATAGCCGCGTCT CCGCTCTGTCTCTGCTGATCCATCGATCACCTACGCATCGATCCCTCGTTCGATCAACGTGGTCATGAGC TGGAGCGTTTGAGCGCCGCTATCAGACTGGCGGCAGAGAAAAACTGAATGGAGGCACCGGCAGTTGGACG CTTTAGAATCCTTGCGTTGTTGACGATATGGCTGGTCCAGCTTGCGGTGCCCGGCGCCATCGCGTCTTAC AGCATCGGGGTGGGCAGAGCAGATGCTACAGGACCCGCCGCTGAAATTGTTTTTATGGGCTACGCGAAGA TCGATCAAAAAGGATCAGGAATCCATCTTCGAACATTCTCCCGCGCATTCATCATCGACGATGGCGAGGA GAGGTTCGTCTTCGTCAGCGTGGATAGCGCCATGATAGGAAACGGCGTTCGTCAAACGGTGTTGCAGAAT CTTGAAAAGGAGTTTGGCAGCCTGTACACAGAGAAAAATGTGATGATCAGTGCAACTCACTCGCACTCCA CACCCGGTGGATTCATGTTGCACATGTTGTTCGATATTACGACATTCGGTTTCGTTCAAGAGACCTTCGA TGCTATGGTCAAGGGAATCACGAAGAGTATTCAACGTGCTCACTATGCCATAGTTCCAGGCAGAATATTC ATCACCCATGGAGAAGTTCATGGTGTGAACATTAATAGAAGCCCATCCG Drag the honey bee gene model(s) you found into the 'User-created Annotation Area' and retrieve its sequence(s) to query the public databases to inspect its/their structure. Query NCBI's nr for orthologs, using BLAST at http://blast.ncbi.nlm.nih.gov/Blast.cgi Check to notice the conserved domains, if any. And if so, are they intact in each model? After inspecting the biological evidence in the area, do you think these models should be brought together? If so, how? Are you able to establish whether you should annotate UTRs to this gene model hypothesis? Once you are satisfied with a final model, check integrity and accuracy: - blastp vs Insecta (at NCBI) (-Apis mellifera) - add GO terms (e.g. from Drosophila entries) - search the literature to add PubMed IDs (http://www.ncbi.nlm.nih.gov/pubmed).
  • 7.     ----------------------------------------------------------------------- # Web Apollo Workshop - KSU # Exercise 6 It has come to our attention that the honey bee ortholog of adenomatous polyposis coli (APC) - like is fragmented into possibly 4 or more genes in the current gene set. In Drosophila melanogaster adenomatous polyposis coli (APC) -like is involved in beta-catenin binding and microtubule binding. APC is a negative regulator that controls Beta-catenin concentrations and interacts with E- cadherin, which are involved in cell adhesion. APC is classified as a tumor suppressor gene. Mutations in the APC gene may result in colorectal cancer. You may use the Camponotus floridanus gene model (EFN68235.1) to pull the corresponding location in Apis mellifera using BLAT. The following is a fragment. >Camponotus floridanus APC-like partial GRVLCGSAASVGVEGVGGAWGAQRRQSPPPLASRRLESAADAVVAAAAAAAVATTAASFNPVTQRCAKKG AVDAVAPRRIYPGPPLVAETSKEDAMEPEAKEEDERRSSTPSPEFYLRRSKRYNEDGSSEEETKQDSISL PNHRLPSSYRGTWPIRRDVWANQQIGFPAQQSTSLAAHNDVASVMSFSSSSNSAGLDSHSVELQGHRRLG AKVDVVYNLLGMLEKNGRDDMSTTLLSMSTSLDSCLVMRQSGCLPLLVQLIHAPRQDPDTRDRAMQALHN VVHAKSDERAGRREARVLRFLEQLRDYCQSLRMSLERGQSMDDLERGHPAATIAALMKLSFDEAHRHAMC QLGGLHAVAELIEMDHLAHGSESDDQNCITLRRYAGMALTNLTFGDGNNKALLCSFKEFMKALVSQLKSP SDDLRQVTASVLRNLSWRADSSSKQTLREVGAVTGLMKAAMEGRKESTLKSILSALWNLSAHCSTNKVDI Check to notice the conserved domains, if any. And if so, are they intact in each model? After inspecting the biological evidence in the area, do you think these models should be brought together? if so, how? Once you are satisfied with a final model, check integrity and accuracy: - blastp vs Insecta (at NCBI) (-Apis mellifera) - add GO terms (e.g. from Drosophila entries) - search the literature to add PubMed IDs (http://www.ncbi.nlm.nih.gov/pubmed).