SlideShare une entreprise Scribd logo
1  sur  24
University of Minnesota




Effectors from flax rust and Puccinia graminis
Gene-for-gene resistance in flax:
    Basic Research Questions




       1. What are rust resistance genes and
             how do they work?


       2. How do rusts overcome resistance?


       3. Can we apply knowledge from the model
       system to cereal rust diseases?
Gene-for-gene resistance in flax

R
                         R genes encode recognition
                      components of plant immune system
S


                  ~30 Rust resistance genes in flax
                         Cloned 20 R genes
R Locus   Cloned
    L     L, L1-L11
                               TIR          NB             LRR
    M     M, M1, M3
    N     N, N1, N2
    P     P, P2              Signalling   Activation   Recognition
Flax rust Avirulence Genes:
    Haustorially expressed secreted proteins


Identified Avr genes from four loci
 - encode small secreted proteins
 - expressed in haustoria                                           HR
                                       R            AVR
 - recognised inside plant cells                                  cell death



                                           L5             Bison
 Avr Locus       Matching R genes
 AvrL567          L5, L6, L7
 AvrM             M
 AvrP123          P, P1, P2, P3
                                        35S
                                      promoter     AvrL567          Nos
 AvrP4            P4
                                                No signal peptide
                                                  (cytoplasmic)
R-Avr recognition occurs by direct interaction



     Receptor ligand model   Avr proteins escape recognition
              R                by altering surface residues
              Avr

                                     AvrL567-A


 Yeast-2-hybrid assays
         AvrL567
       A    B    D
L5
                                      AvrL567-D

      AvrM   avrM

M
Flax rust AvrM protein secreted and
      translocated to host cell
             Anti-haustoria           Anti-AvrM




                                        Plant
                                        Cytoplasm




                    Haustorium

                     0.5 μm


                                 Rafiqi et al Plant Cell 2010 22:2017
AvrM protein is taken up in host vesicles




       Haustorium                            Plant
                                             cytoplasm




             Plant          Haustorium
             cytoplasm

                         Pamela Gan and Adrienne Hardham et al unpublished
AvrM in the plant endomembrane system




                  Plant
                  cytoplasm




    Haustorium


                  Pamela Gan and Adrienne Hardham et al unpublished
Effector delivery is pathogen-independent and
 requires N-terminal uptake signals
                                   Plasmolysed cells




      SP-GFP




SP-AvrM-GFP




              SP                             GFP
                   Uptake signal

        MKFLKPDQVQKLSTDDLITYMAEKDKNVRDL
          FL    V Ls    LI Yqaekd
                                               Rafiqi et al Plant Cell 2010 22:2017
Effector delivery from transgenic rust also
    requires the N-terminal uptake signal




M



    CH5F2-96               AvrM-YFP               AvrM-∆106-153-YFP
Secreted effectors in rust infection and host
immunity




                              R
                          Immune
                            Host
                         Recognition
                         Manipulation
Stem rust effectoromics

• What is the set of stem rust effector proteins?
   > Secreted (have signal peptide)
   > Expressed in haustoria


• Which of these are recognised by wheat R genes?
   > Genetic association
   > Functional assays
Wheat stem rust genomic resources


Reference genome – strain CRL75-36-700 (7a)
  Broad Institute (Cuomo, Szabo)
      - 81.5 Mbp; ~92% coverage
      - 20,567 genes annotated
      - 1342 have signal peptides for secretion




Four Australian isolates – represent founder strains
      - 21-0
      - 126
      - 194
      - 326
Identifying stem rust effector genes
                                        Isolated haustoria
• Haustorial isolation (21-0)                haustoria
   > 13K ESTs
   > Illumina RNAseq



• Genome sequence
        - 21-0           454/Illumina
        - 126            Illumina
        - 194            Illumina
        - 326            Illumina


• Illumina RNAseq – infected tissue
        - 21-0           - 194
        - 126            - 326
Identifying stem rust effector genes

21-0 Haustorial ESTs       7a reference genome

 212 with SP           -   84 predicted SP
                           56 no SP (incorrect annotation)
                           77 absent

 105 no SP             -   predicted SP
 (incomplete clones)




 - Manually curate using genome and RNAseq data
      369 candidates
p7a genome-assisted building of 21-0 reference
                   genome
   Assembled on 7a ref (79 Mbp)
   De novo assembly of non-aligned reads (18 Mbp)




               Mbp



Gene calling based on Illumina RNAseq data

    Gene models                     13,921          5370

    Candidate effectors             339             30
Sequence Variations Among Different Pgt Isolates



    21-0
anchored

                                                                                                        100
    pg7a




                                                                                                              % Similarity Plot
                                                                                                        80


      126                                                                                               100
                                                                                                        80

      326                                                                                               100
                                                                                                        80
                                                                                                        100
      194
                                                                                                        80
                                            SuperContig1
  Pgt-p7a genome assisted assembly of Pgt-21-0 genome and subsequent assembly of genomes of other Australian strains
                assisted by derived Pgt21-0 genome (Illumina GAII/HiSeq 100 bp paired-end sequencing)
Strain variation in effector genes

Only 13 effector candidates show no differences between five strains
         ~40 have < 5 SNPs across five strains

                    SNPs in secreted effector genes
                     reference                             Protein
                         strain                            length
          gene             7a     126   194   21-0   326      (aa)
       PGTT_02220       15        18    20    10     5      189
       PGTT_19738        7        18    17     7     4      209
       PGTT_01618       23        30    27    12     8      354
       PGTT_07595       17        19    29    15     10     339
       PGTT_09048                 17    14     4     3      177
       PGTT_05791                  9     6     5     2      103
       PGTT_13278       21        26    31    20     12     425
       PGTT_10668                 9     9      6     1      123
       PGTT_12848        7        7     17     2     2      138
       PGTT_00796                 9     11     2     1      115
       PGTT_02680                 14    10     2            134
       PGTT_06969        5         9    23     5      4     217
       PGTT_08533       10        11     9     1     1      117
Expression variation of candidate effectors
 Relative
             18.00 absent
Expression                  ~100fold       absent
  (log2)     16.00
             14.00
             12.00
             10.00
              8.00
              6.00
              4.00                                  HS_210
              2.00                                  210

              0.00                                  126
                                                    194.00
                                                    326.00
Functional Assay: bacterial type 3 delivery

         Pseudomonas fluorescens ‘Ethan’ (Pfo):
                Express as fusion to AvrRPM1 bacterial effector


       Adenylate cyclase                             AvrM delivery
        delivery to wheat                           to tobacco (M)
       cAMP mg/protein
7000
6000
5000                                                                 Agro:
4000                                    mock                         avrM
3000
2000                                                                 Agro:
1000                                     Pfo                         AvrM
   0
                                                                     Pfo:
                                    Pfo:                             avrM
                                    AvrRPM1
                                                                     Pfo:
                                                                     AvrM
Wheat accessions with different R genes


                                                 Pfo inoculation
     Differentials            R genes
BW56                 Sr31
Acme                 Sr9g, SrX
Agent                Sr24
Comb X               Sr5b, Sr7b, Sr9b
Festiguay            Sr30
Gatcher L06-139      Sr2, Sr5, Sr6, Sr8a, Sr12
Kite                 Sr26
Banks L09-94         Sr5, Sr8a, Sr9b, Sr12
Line S L09_10        Sr13, Sr17                    DAB stain
Mendos L09_89        Sr11,Sr17, Sr36
Norka L09_95         Sr15
Trident L09_91       Sr38
W3534                Sr22
Screening Effector Candidates

                                    13 Wheat accessions


1                               2                          3


4                               5                          6



7                               8                          9



10                         11                              12

     Treatments:                     5.   Lcontig10 al4
     1. Mock                         6.   Lcontig625_al1
     2. Pfo Ethan/AvrRPM1:Cya        7.   Lcontig75_al1
                                                           13
     3. Lcontig10 _al1               8.   Lcontig10 al6
     4. Lcontig10 _al3               9.   Lcontig10 al7
Two potential effector-R gene recognition
                 responses
Kite Sr26                                Norka Sr15
                    Treatments
                       Mock

              G1LContig1_al1_G1#1-1


              G1LContig1_al5_G1#1-9


             G1LContig7_al1-al2_G1#2-4


              G1LContig7_al3_G1#2-7


              G1LContig7_al4_G1#2-3
Acknowledgements



CSIRO-Plant Industry   U. Sydney          ANU
Narayana Upadhyaya      Robert Park       Adrienne Hardham
Robyn East              Colin Wellings    David Jones
Rohit Mago                                Pamela Gan
                       U. Minnesota       Maryam Rafiqi
Jeff Ellis              Les Szabo
Xiaodi Xia              Jerry Johnson
Kim Newell              Jane Glazebrook
Jen Taylor              Fumi Katagiri
Andrew Spriggs
Maud Bernoux           Broad Institute
Greg Lawrence           Christina Cuomo
                        Jane Wilkinson


                         Two Blades
                         Foundation

Contenu connexe

Tendances

An approach to describing and analysing bulk biological annotation quality: a...
An approach to describing and analysing bulk biological annotation quality: a...An approach to describing and analysing bulk biological annotation quality: a...
An approach to describing and analysing bulk biological annotation quality: a...Michael Bell
 
Cleft lip and palate: Examining variations on ZEB1 gene
Cleft lip and palate: Examining variations on ZEB1 geneCleft lip and palate: Examining variations on ZEB1 gene
Cleft lip and palate: Examining variations on ZEB1 geneJingwen Zhang
 
PRODUCTION OF SEROTYPE 6-DERIVED RECOMBINANT ADENO-ASSOCIATED VIRUS IN SERUM-...
PRODUCTION OF SEROTYPE 6-DERIVED RECOMBINANT ADENO-ASSOCIATED VIRUS IN SERUM-...PRODUCTION OF SEROTYPE 6-DERIVED RECOMBINANT ADENO-ASSOCIATED VIRUS IN SERUM-...
PRODUCTION OF SEROTYPE 6-DERIVED RECOMBINANT ADENO-ASSOCIATED VIRUS IN SERUM-...Dr. Érica Schulze
 
Sequencing cannabis sativa and cannabis indica, Courtagen Life Sciences, Inc,...
Sequencing cannabis sativa and cannabis indica, Courtagen Life Sciences, Inc,...Sequencing cannabis sativa and cannabis indica, Courtagen Life Sciences, Inc,...
Sequencing cannabis sativa and cannabis indica, Courtagen Life Sciences, Inc,...Copenhagenomics
 
S4.1 Genomics-assisted breeding for maize improvement
S4.1  Genomics-assisted breeding for maize improvementS4.1  Genomics-assisted breeding for maize improvement
S4.1 Genomics-assisted breeding for maize improvementCIMMYT
 
Research and application of plant immunity
Research and application of plant immunityResearch and application of plant immunity
Research and application of plant immunityFOODCROPS
 
Multipex reverse transcription for detection of viruses
Multipex reverse transcription for detection of virusesMultipex reverse transcription for detection of viruses
Multipex reverse transcription for detection of virusesSwatiraj Tyagi
 
Pb Stem Cell Engineering
Pb Stem Cell EngineeringPb Stem Cell Engineering
Pb Stem Cell EngineeringJack Crawford
 
Smith,Jacob,MVB_Poster
Smith,Jacob,MVB_PosterSmith,Jacob,MVB_Poster
Smith,Jacob,MVB_PosterJacob Smith
 
Will_4-13-15_GroupMtng_Final
Will_4-13-15_GroupMtng_FinalWill_4-13-15_GroupMtng_Final
Will_4-13-15_GroupMtng_FinalWilliam Daggett
 

Tendances (14)

An approach to describing and analysing bulk biological annotation quality: a...
An approach to describing and analysing bulk biological annotation quality: a...An approach to describing and analysing bulk biological annotation quality: a...
An approach to describing and analysing bulk biological annotation quality: a...
 
Cleft lip and palate: Examining variations on ZEB1 gene
Cleft lip and palate: Examining variations on ZEB1 geneCleft lip and palate: Examining variations on ZEB1 gene
Cleft lip and palate: Examining variations on ZEB1 gene
 
IHC Polymer
IHC PolymerIHC Polymer
IHC Polymer
 
IHC Link-Label
IHC Link-LabelIHC Link-Label
IHC Link-Label
 
PRODUCTION OF SEROTYPE 6-DERIVED RECOMBINANT ADENO-ASSOCIATED VIRUS IN SERUM-...
PRODUCTION OF SEROTYPE 6-DERIVED RECOMBINANT ADENO-ASSOCIATED VIRUS IN SERUM-...PRODUCTION OF SEROTYPE 6-DERIVED RECOMBINANT ADENO-ASSOCIATED VIRUS IN SERUM-...
PRODUCTION OF SEROTYPE 6-DERIVED RECOMBINANT ADENO-ASSOCIATED VIRUS IN SERUM-...
 
Sequencing cannabis sativa and cannabis indica, Courtagen Life Sciences, Inc,...
Sequencing cannabis sativa and cannabis indica, Courtagen Life Sciences, Inc,...Sequencing cannabis sativa and cannabis indica, Courtagen Life Sciences, Inc,...
Sequencing cannabis sativa and cannabis indica, Courtagen Life Sciences, Inc,...
 
吳譽茱
吳譽茱吳譽茱
吳譽茱
 
S4.1 Genomics-assisted breeding for maize improvement
S4.1  Genomics-assisted breeding for maize improvementS4.1  Genomics-assisted breeding for maize improvement
S4.1 Genomics-assisted breeding for maize improvement
 
Research and application of plant immunity
Research and application of plant immunityResearch and application of plant immunity
Research and application of plant immunity
 
Multipex reverse transcription for detection of viruses
Multipex reverse transcription for detection of virusesMultipex reverse transcription for detection of viruses
Multipex reverse transcription for detection of viruses
 
Pb Stem Cell Engineering
Pb Stem Cell EngineeringPb Stem Cell Engineering
Pb Stem Cell Engineering
 
Prediction the outcome of Lung Transplantation within the COLT cohort
Prediction the outcome of Lung Transplantation within the COLT cohortPrediction the outcome of Lung Transplantation within the COLT cohort
Prediction the outcome of Lung Transplantation within the COLT cohort
 
Smith,Jacob,MVB_Poster
Smith,Jacob,MVB_PosterSmith,Jacob,MVB_Poster
Smith,Jacob,MVB_Poster
 
Will_4-13-15_GroupMtng_Final
Will_4-13-15_GroupMtng_FinalWill_4-13-15_GroupMtng_Final
Will_4-13-15_GroupMtng_Final
 

En vedette

En vedette (14)

Spar конференция в норвегии
Spar конференция в  норвегииSpar конференция в  норвегии
Spar конференция в норвегии
 
An overexpression screen to determine how Legionella pneumophila effector pro...
An overexpression screen to determine how Legionella pneumophila effector pro...An overexpression screen to determine how Legionella pneumophila effector pro...
An overexpression screen to determine how Legionella pneumophila effector pro...
 
2nd stripe rust izmir
2nd stripe rust izmir2nd stripe rust izmir
2nd stripe rust izmir
 
11-1_P1456235
11-1_P145623511-1_P1456235
11-1_P1456235
 
Cabg awam
Cabg awamCabg awam
Cabg awam
 
High Blood Pressure
High Blood PressureHigh Blood Pressure
High Blood Pressure
 
Epidemiology
EpidemiologyEpidemiology
Epidemiology
 
Connecting routes in the central nervous system
Connecting routes in the central nervous systemConnecting routes in the central nervous system
Connecting routes in the central nervous system
 
Dasar Keterampilan Berkomunikasi
Dasar Keterampilan BerkomunikasiDasar Keterampilan Berkomunikasi
Dasar Keterampilan Berkomunikasi
 
Pe talk sep 21 dr.anjali
Pe talk sep 21 dr.anjaliPe talk sep 21 dr.anjali
Pe talk sep 21 dr.anjali
 
Cranio vertebral junction / Foramen magnum 360°
Cranio vertebral junction / Foramen magnum 360°Cranio vertebral junction / Foramen magnum 360°
Cranio vertebral junction / Foramen magnum 360°
 
Acute urinary retention mgt
Acute urinary retention mgtAcute urinary retention mgt
Acute urinary retention mgt
 
Essentials of CT brain (For Undergraduates)
Essentials of CT brain (For Undergraduates)Essentials of CT brain (For Undergraduates)
Essentials of CT brain (For Undergraduates)
 
Plant - Pathogen Interaction and Disease Development
Plant - Pathogen Interaction and Disease DevelopmentPlant - Pathogen Interaction and Disease Development
Plant - Pathogen Interaction and Disease Development
 

Similaire à Dodds

Discriminating Facts from Artefacts in the Secreted Ly-6 Protein Family
Discriminating Facts from Artefacts in the Secreted Ly-6 Protein FamilyDiscriminating Facts from Artefacts in the Secreted Ly-6 Protein Family
Discriminating Facts from Artefacts in the Secreted Ly-6 Protein FamilyChris Southan
 
RNA interference Activity in Glassy-winged Sharpshooter Cells and Whole Insec...
RNA interference Activity in Glassy-winged Sharpshooter Cells and Whole Insec...RNA interference Activity in Glassy-winged Sharpshooter Cells and Whole Insec...
RNA interference Activity in Glassy-winged Sharpshooter Cells and Whole Insec...huyng
 
Isolation of genes differentially expressed during the defense response of Ca...
Isolation of genes differentially expressed during the defense response of Ca...Isolation of genes differentially expressed during the defense response of Ca...
Isolation of genes differentially expressed during the defense response of Ca...CIAT
 
Towards a vaccine for African swine fever
Towards a vaccine for African swine feverTowards a vaccine for African swine fever
Towards a vaccine for African swine feverILRI
 
Isolation of genes differentially expressed during the defense response of Ca...
Isolation of genes differentially expressed during the defense response of Ca...Isolation of genes differentially expressed during the defense response of Ca...
Isolation of genes differentially expressed during the defense response of Ca...CIAT
 
An introduction to RNAi technology - Petr Svoboda - Institute of Molecular Ge...
An introduction to RNAi technology - Petr Svoboda - Institute of Molecular Ge...An introduction to RNAi technology - Petr Svoboda - Institute of Molecular Ge...
An introduction to RNAi technology - Petr Svoboda - Institute of Molecular Ge...OECD Environment
 
20081216 06陳倩琪 紅麴菌基因體之定序與分析
20081216 06陳倩琪 紅麴菌基因體之定序與分析20081216 06陳倩琪 紅麴菌基因體之定序與分析
20081216 06陳倩琪 紅麴菌基因體之定序與分析Monascus2008
 
Molecular markers types and applications
Molecular markers types and applicationsMolecular markers types and applications
Molecular markers types and applicationsFAO
 
同玩節海報事件
同玩節海報事件同玩節海報事件
同玩節海報事件lalacamp07
 
Jonathan Eisen talk on "Phylogenomics of Microbes" at Lake Arrowhead Small Ge...
Jonathan Eisen talk on "Phylogenomics of Microbes" at Lake Arrowhead Small Ge...Jonathan Eisen talk on "Phylogenomics of Microbes" at Lake Arrowhead Small Ge...
Jonathan Eisen talk on "Phylogenomics of Microbes" at Lake Arrowhead Small Ge...Jonathan Eisen
 
Izmir rust final final
Izmir rust final finalIzmir rust final final
Izmir rust final finalICARDA
 
Reducing off-target events in CRISPR genome editing applications with a novel...
Reducing off-target events in CRISPR genome editing applications with a novel...Reducing off-target events in CRISPR genome editing applications with a novel...
Reducing off-target events in CRISPR genome editing applications with a novel...Integrated DNA Technologies
 
NGS data analysis Overview
NGS data analysis Overview NGS data analysis Overview
NGS data analysis Overview Ravi Gandham
 

Similaire à Dodds (20)

Snp genotyping
Snp genotypingSnp genotyping
Snp genotyping
 
Cell 671
Cell 671Cell 671
Cell 671
 
Katagiri i 110614
Katagiri i 110614Katagiri i 110614
Katagiri i 110614
 
Discriminating Facts from Artefacts in the Secreted Ly-6 Protein Family
Discriminating Facts from Artefacts in the Secreted Ly-6 Protein FamilyDiscriminating Facts from Artefacts in the Secreted Ly-6 Protein Family
Discriminating Facts from Artefacts in the Secreted Ly-6 Protein Family
 
RNA interference Activity in Glassy-winged Sharpshooter Cells and Whole Insec...
RNA interference Activity in Glassy-winged Sharpshooter Cells and Whole Insec...RNA interference Activity in Glassy-winged Sharpshooter Cells and Whole Insec...
RNA interference Activity in Glassy-winged Sharpshooter Cells and Whole Insec...
 
Isolation of genes differentially expressed during the defense response of Ca...
Isolation of genes differentially expressed during the defense response of Ca...Isolation of genes differentially expressed during the defense response of Ca...
Isolation of genes differentially expressed during the defense response of Ca...
 
Towards a vaccine for African swine fever
Towards a vaccine for African swine feverTowards a vaccine for African swine fever
Towards a vaccine for African swine fever
 
Isolation of genes differentially expressed during the defense response of Ca...
Isolation of genes differentially expressed during the defense response of Ca...Isolation of genes differentially expressed during the defense response of Ca...
Isolation of genes differentially expressed during the defense response of Ca...
 
An introduction to RNAi technology - Petr Svoboda - Institute of Molecular Ge...
An introduction to RNAi technology - Petr Svoboda - Institute of Molecular Ge...An introduction to RNAi technology - Petr Svoboda - Institute of Molecular Ge...
An introduction to RNAi technology - Petr Svoboda - Institute of Molecular Ge...
 
Ap2 Alpha
Ap2 AlphaAp2 Alpha
Ap2 Alpha
 
20081216 06陳倩琪 紅麴菌基因體之定序與分析
20081216 06陳倩琪 紅麴菌基因體之定序與分析20081216 06陳倩琪 紅麴菌基因體之定序與分析
20081216 06陳倩琪 紅麴菌基因體之定序與分析
 
Molecular markers types and applications
Molecular markers types and applicationsMolecular markers types and applications
Molecular markers types and applications
 
同玩節海報事件
同玩節海報事件同玩節海報事件
同玩節海報事件
 
Jonathan Eisen talk on "Phylogenomics of Microbes" at Lake Arrowhead Small Ge...
Jonathan Eisen talk on "Phylogenomics of Microbes" at Lake Arrowhead Small Ge...Jonathan Eisen talk on "Phylogenomics of Microbes" at Lake Arrowhead Small Ge...
Jonathan Eisen talk on "Phylogenomics of Microbes" at Lake Arrowhead Small Ge...
 
Pcr array guide
Pcr array guidePcr array guide
Pcr array guide
 
Izmir rust final final
Izmir rust final finalIzmir rust final final
Izmir rust final final
 
060516_UMH_AC
060516_UMH_AC060516_UMH_AC
060516_UMH_AC
 
Chigot poster2007
Chigot poster2007Chigot poster2007
Chigot poster2007
 
Reducing off-target events in CRISPR genome editing applications with a novel...
Reducing off-target events in CRISPR genome editing applications with a novel...Reducing off-target events in CRISPR genome editing applications with a novel...
Reducing off-target events in CRISPR genome editing applications with a novel...
 
NGS data analysis Overview
NGS data analysis Overview NGS data analysis Overview
NGS data analysis Overview
 

Plus de Borlaug Global Rust Initiative

A comparison of stem rust in oats and yellow rust in wheat: A Swedish example
A comparison of stem rust in oats and yellow rust in wheat: A Swedish exampleA comparison of stem rust in oats and yellow rust in wheat: A Swedish example
A comparison of stem rust in oats and yellow rust in wheat: A Swedish exampleBorlaug Global Rust Initiative
 
Sources of Stem Rust Resistance in Cultivated and Wild Tetraploids
Sources of Stem Rust Resistance in Cultivated and Wild TetraploidsSources of Stem Rust Resistance in Cultivated and Wild Tetraploids
Sources of Stem Rust Resistance in Cultivated and Wild TetraploidsBorlaug Global Rust Initiative
 
Agrovegetal 15 years of releasing new wheat cultivars for Spanish farmers
Agrovegetal 15 years of releasing new wheat cultivars for Spanish farmers Agrovegetal 15 years of releasing new wheat cultivars for Spanish farmers
Agrovegetal 15 years of releasing new wheat cultivars for Spanish farmers Borlaug Global Rust Initiative
 
Public-­‐Private Partnership in India: A Need for breakthrough in Whe...
Public-­‐Private  Partnership  in  India: A  Need  for  breakthrough  in  Whe...Public-­‐Private  Partnership  in  India: A  Need  for  breakthrough  in  Whe...
Public-­‐Private Partnership in India: A Need for breakthrough in Whe...Borlaug Global Rust Initiative
 
The Global O currence and Economic Consequences of Stripe Rust in Wheat
The Global O currence and Economic Consequences of Stripe Rust in WheatThe Global O currence and Economic Consequences of Stripe Rust in Wheat
The Global O currence and Economic Consequences of Stripe Rust in WheatBorlaug Global Rust Initiative
 
Population divergence in the wheat leaf rust fungus Puccinia triticina is cor...
Population divergence in the wheat leaf rust fungus Puccinia triticina is cor...Population divergence in the wheat leaf rust fungus Puccinia triticina is cor...
Population divergence in the wheat leaf rust fungus Puccinia triticina is cor...Borlaug Global Rust Initiative
 
Molecular characterization of Pst isolates from Western Canada
Molecular characterization of Pst isolates from Western CanadaMolecular characterization of Pst isolates from Western Canada
Molecular characterization of Pst isolates from Western CanadaBorlaug Global Rust Initiative
 
Characterization of pleiotropic adult plant resistance loci to wheat diseases
Characterization of pleiotropic adult plant resistance loci to wheat diseases Characterization of pleiotropic adult plant resistance loci to wheat diseases
Characterization of pleiotropic adult plant resistance loci to wheat diseases Borlaug Global Rust Initiative
 
New evidence supporting the occurrence of sexual reproduction in the wheat st...
New evidence supporting the occurrence of sexual reproduction in the wheat st...New evidence supporting the occurrence of sexual reproduction in the wheat st...
New evidence supporting the occurrence of sexual reproduction in the wheat st...Borlaug Global Rust Initiative
 
Achieving sustainable leaf rust control in durum wheat: What have we...
Achieving  sustainable  leaf  rust  control  in  durum  wheat: What  have  we...Achieving  sustainable  leaf  rust  control  in  durum  wheat: What  have  we...
Achieving sustainable leaf rust control in durum wheat: What have we...Borlaug Global Rust Initiative
 
Denmark's investment in the Global Rust Reference Center (GRRC)
Denmark's investment in the Global Rust Reference Center (GRRC)Denmark's investment in the Global Rust Reference Center (GRRC)
Denmark's investment in the Global Rust Reference Center (GRRC)Borlaug Global Rust Initiative
 
BGRI 2009- 2014: An effective platform for global coordination
BGRI 2009- 2014: An effective platform for global coordinationBGRI 2009- 2014: An effective platform for global coordination
BGRI 2009- 2014: An effective platform for global coordinationBorlaug Global Rust Initiative
 
Antagonistic Interactions Among Stripe and Stem Rust Resistance QTLs in Wheat
Antagonistic Interactions Among Stripe and Stem Rust Resistance QTLs in WheatAntagonistic Interactions Among Stripe and Stem Rust Resistance QTLs in Wheat
Antagonistic Interactions Among Stripe and Stem Rust Resistance QTLs in WheatBorlaug Global Rust Initiative
 

Plus de Borlaug Global Rust Initiative (20)

A comparison of stem rust in oats and yellow rust in wheat: A Swedish example
A comparison of stem rust in oats and yellow rust in wheat: A Swedish exampleA comparison of stem rust in oats and yellow rust in wheat: A Swedish example
A comparison of stem rust in oats and yellow rust in wheat: A Swedish example
 
2013 Wheat Stem Rust Outbreaks: Global Response
2013 Wheat Stem Rust Outbreaks: Global Response 2013 Wheat Stem Rust Outbreaks: Global Response
2013 Wheat Stem Rust Outbreaks: Global Response
 
Sources of Stem Rust Resistance in Cultivated and Wild Tetraploids
Sources of Stem Rust Resistance in Cultivated and Wild TetraploidsSources of Stem Rust Resistance in Cultivated and Wild Tetraploids
Sources of Stem Rust Resistance in Cultivated and Wild Tetraploids
 
Agrovegetal 15 years of releasing new wheat cultivars for Spanish farmers
Agrovegetal 15 years of releasing new wheat cultivars for Spanish farmers Agrovegetal 15 years of releasing new wheat cultivars for Spanish farmers
Agrovegetal 15 years of releasing new wheat cultivars for Spanish farmers
 
Field pathogenomics of wheat yellow (stripe) rust
Field pathogenomics of wheat yellow (stripe) rust Field pathogenomics of wheat yellow (stripe) rust
Field pathogenomics of wheat yellow (stripe) rust
 
Public-­‐Private Partnership in India: A Need for breakthrough in Whe...
Public-­‐Private  Partnership  in  India: A  Need  for  breakthrough  in  Whe...Public-­‐Private  Partnership  in  India: A  Need  for  breakthrough  in  Whe...
Public-­‐Private Partnership in India: A Need for breakthrough in Whe...
 
Importance of data sharing and germplasm movement
Importance of data sharing and germplasm movementImportance of data sharing and germplasm movement
Importance of data sharing and germplasm movement
 
The Global O currence and Economic Consequences of Stripe Rust in Wheat
The Global O currence and Economic Consequences of Stripe Rust in WheatThe Global O currence and Economic Consequences of Stripe Rust in Wheat
The Global O currence and Economic Consequences of Stripe Rust in Wheat
 
Population divergence in the wheat leaf rust fungus Puccinia triticina is cor...
Population divergence in the wheat leaf rust fungus Puccinia triticina is cor...Population divergence in the wheat leaf rust fungus Puccinia triticina is cor...
Population divergence in the wheat leaf rust fungus Puccinia triticina is cor...
 
Molecular characterization of Pst isolates from Western Canada
Molecular characterization of Pst isolates from Western CanadaMolecular characterization of Pst isolates from Western Canada
Molecular characterization of Pst isolates from Western Canada
 
Characterization of pleiotropic adult plant resistance loci to wheat diseases
Characterization of pleiotropic adult plant resistance loci to wheat diseases Characterization of pleiotropic adult plant resistance loci to wheat diseases
Characterization of pleiotropic adult plant resistance loci to wheat diseases
 
New evidence supporting the occurrence of sexual reproduction in the wheat st...
New evidence supporting the occurrence of sexual reproduction in the wheat st...New evidence supporting the occurrence of sexual reproduction in the wheat st...
New evidence supporting the occurrence of sexual reproduction in the wheat st...
 
2014 bgri gichangi
2014 bgri gichangi2014 bgri gichangi
2014 bgri gichangi
 
2014 bgri de pauw presentation
2014 bgri de pauw presentation2014 bgri de pauw presentation
2014 bgri de pauw presentation
 
2014 bgri dieseth presentation
2014 bgri dieseth presentation2014 bgri dieseth presentation
2014 bgri dieseth presentation
 
Achieving sustainable leaf rust control in durum wheat: What have we...
Achieving  sustainable  leaf  rust  control  in  durum  wheat: What  have  we...Achieving  sustainable  leaf  rust  control  in  durum  wheat: What  have  we...
Achieving sustainable leaf rust control in durum wheat: What have we...
 
Denmark's investment in the Global Rust Reference Center (GRRC)
Denmark's investment in the Global Rust Reference Center (GRRC)Denmark's investment in the Global Rust Reference Center (GRRC)
Denmark's investment in the Global Rust Reference Center (GRRC)
 
BGRI 2009- 2014: An effective platform for global coordination
BGRI 2009- 2014: An effective platform for global coordinationBGRI 2009- 2014: An effective platform for global coordination
BGRI 2009- 2014: An effective platform for global coordination
 
Antagonistic Interactions Among Stripe and Stem Rust Resistance QTLs in Wheat
Antagonistic Interactions Among Stripe and Stem Rust Resistance QTLs in WheatAntagonistic Interactions Among Stripe and Stem Rust Resistance QTLs in Wheat
Antagonistic Interactions Among Stripe and Stem Rust Resistance QTLs in Wheat
 
2014 bgri dodds rev
2014 bgri dodds rev2014 bgri dodds rev
2014 bgri dodds rev
 

Dodds

  • 1. University of Minnesota Effectors from flax rust and Puccinia graminis
  • 2. Gene-for-gene resistance in flax: Basic Research Questions 1. What are rust resistance genes and how do they work? 2. How do rusts overcome resistance? 3. Can we apply knowledge from the model system to cereal rust diseases?
  • 3. Gene-for-gene resistance in flax R R genes encode recognition components of plant immune system S ~30 Rust resistance genes in flax Cloned 20 R genes R Locus Cloned L L, L1-L11 TIR NB LRR M M, M1, M3 N N, N1, N2 P P, P2 Signalling Activation Recognition
  • 4. Flax rust Avirulence Genes: Haustorially expressed secreted proteins Identified Avr genes from four loci - encode small secreted proteins - expressed in haustoria HR R AVR - recognised inside plant cells cell death L5 Bison Avr Locus Matching R genes AvrL567 L5, L6, L7 AvrM M AvrP123 P, P1, P2, P3 35S promoter AvrL567 Nos AvrP4 P4 No signal peptide (cytoplasmic)
  • 5. R-Avr recognition occurs by direct interaction Receptor ligand model Avr proteins escape recognition R by altering surface residues Avr AvrL567-A Yeast-2-hybrid assays AvrL567 A B D L5 AvrL567-D AvrM avrM M
  • 6. Flax rust AvrM protein secreted and translocated to host cell Anti-haustoria Anti-AvrM Plant Cytoplasm Haustorium 0.5 μm Rafiqi et al Plant Cell 2010 22:2017
  • 7. AvrM protein is taken up in host vesicles Haustorium Plant cytoplasm Plant Haustorium cytoplasm Pamela Gan and Adrienne Hardham et al unpublished
  • 8. AvrM in the plant endomembrane system Plant cytoplasm Haustorium Pamela Gan and Adrienne Hardham et al unpublished
  • 9. Effector delivery is pathogen-independent and requires N-terminal uptake signals Plasmolysed cells SP-GFP SP-AvrM-GFP SP GFP Uptake signal MKFLKPDQVQKLSTDDLITYMAEKDKNVRDL FL V Ls LI Yqaekd Rafiqi et al Plant Cell 2010 22:2017
  • 10. Effector delivery from transgenic rust also requires the N-terminal uptake signal M CH5F2-96 AvrM-YFP AvrM-∆106-153-YFP
  • 11. Secreted effectors in rust infection and host immunity R Immune Host Recognition Manipulation
  • 12. Stem rust effectoromics • What is the set of stem rust effector proteins? > Secreted (have signal peptide) > Expressed in haustoria • Which of these are recognised by wheat R genes? > Genetic association > Functional assays
  • 13. Wheat stem rust genomic resources Reference genome – strain CRL75-36-700 (7a) Broad Institute (Cuomo, Szabo) - 81.5 Mbp; ~92% coverage - 20,567 genes annotated - 1342 have signal peptides for secretion Four Australian isolates – represent founder strains - 21-0 - 126 - 194 - 326
  • 14. Identifying stem rust effector genes Isolated haustoria • Haustorial isolation (21-0) haustoria > 13K ESTs > Illumina RNAseq • Genome sequence - 21-0 454/Illumina - 126 Illumina - 194 Illumina - 326 Illumina • Illumina RNAseq – infected tissue - 21-0 - 194 - 126 - 326
  • 15. Identifying stem rust effector genes 21-0 Haustorial ESTs 7a reference genome 212 with SP - 84 predicted SP 56 no SP (incorrect annotation) 77 absent 105 no SP - predicted SP (incomplete clones) - Manually curate using genome and RNAseq data 369 candidates
  • 16. p7a genome-assisted building of 21-0 reference genome Assembled on 7a ref (79 Mbp) De novo assembly of non-aligned reads (18 Mbp) Mbp Gene calling based on Illumina RNAseq data Gene models 13,921 5370 Candidate effectors 339 30
  • 17. Sequence Variations Among Different Pgt Isolates 21-0 anchored 100 pg7a % Similarity Plot 80 126 100 80 326 100 80 100 194 80 SuperContig1 Pgt-p7a genome assisted assembly of Pgt-21-0 genome and subsequent assembly of genomes of other Australian strains assisted by derived Pgt21-0 genome (Illumina GAII/HiSeq 100 bp paired-end sequencing)
  • 18. Strain variation in effector genes Only 13 effector candidates show no differences between five strains ~40 have < 5 SNPs across five strains SNPs in secreted effector genes reference Protein strain length gene 7a 126 194 21-0 326 (aa) PGTT_02220 15 18 20 10 5 189 PGTT_19738 7 18 17 7 4 209 PGTT_01618 23 30 27 12 8 354 PGTT_07595 17 19 29 15 10 339 PGTT_09048 17 14 4 3 177 PGTT_05791 9 6 5 2 103 PGTT_13278 21 26 31 20 12 425 PGTT_10668 9 9 6 1 123 PGTT_12848 7 7 17 2 2 138 PGTT_00796 9 11 2 1 115 PGTT_02680 14 10 2 134 PGTT_06969 5 9 23 5 4 217 PGTT_08533 10 11 9 1 1 117
  • 19. Expression variation of candidate effectors Relative 18.00 absent Expression ~100fold absent (log2) 16.00 14.00 12.00 10.00 8.00 6.00 4.00 HS_210 2.00 210 0.00 126 194.00 326.00
  • 20. Functional Assay: bacterial type 3 delivery Pseudomonas fluorescens ‘Ethan’ (Pfo): Express as fusion to AvrRPM1 bacterial effector Adenylate cyclase AvrM delivery delivery to wheat to tobacco (M) cAMP mg/protein 7000 6000 5000 Agro: 4000 mock avrM 3000 2000 Agro: 1000 Pfo AvrM 0 Pfo: Pfo: avrM AvrRPM1 Pfo: AvrM
  • 21. Wheat accessions with different R genes Pfo inoculation Differentials R genes BW56 Sr31 Acme Sr9g, SrX Agent Sr24 Comb X Sr5b, Sr7b, Sr9b Festiguay Sr30 Gatcher L06-139 Sr2, Sr5, Sr6, Sr8a, Sr12 Kite Sr26 Banks L09-94 Sr5, Sr8a, Sr9b, Sr12 Line S L09_10 Sr13, Sr17 DAB stain Mendos L09_89 Sr11,Sr17, Sr36 Norka L09_95 Sr15 Trident L09_91 Sr38 W3534 Sr22
  • 22. Screening Effector Candidates 13 Wheat accessions 1 2 3 4 5 6 7 8 9 10 11 12 Treatments: 5. Lcontig10 al4 1. Mock 6. Lcontig625_al1 2. Pfo Ethan/AvrRPM1:Cya 7. Lcontig75_al1 13 3. Lcontig10 _al1 8. Lcontig10 al6 4. Lcontig10 _al3 9. Lcontig10 al7
  • 23. Two potential effector-R gene recognition responses Kite Sr26 Norka Sr15 Treatments Mock G1LContig1_al1_G1#1-1 G1LContig1_al5_G1#1-9 G1LContig7_al1-al2_G1#2-4 G1LContig7_al3_G1#2-7 G1LContig7_al4_G1#2-3
  • 24. Acknowledgements CSIRO-Plant Industry U. Sydney ANU Narayana Upadhyaya Robert Park Adrienne Hardham Robyn East Colin Wellings David Jones Rohit Mago Pamela Gan U. Minnesota Maryam Rafiqi Jeff Ellis Les Szabo Xiaodi Xia Jerry Johnson Kim Newell Jane Glazebrook Jen Taylor Fumi Katagiri Andrew Spriggs Maud Bernoux Broad Institute Greg Lawrence Christina Cuomo Jane Wilkinson Two Blades Foundation